DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and Zscan4b

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001172102.1 Gene:Zscan4b / 665780 MGIID:3645447 Length:505 Species:Mus musculus


Alignment Length:188 Identity:52/188 - (27%)
Similarity:87/188 - (46%) Gaps:25/188 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CLVADVSDCLECRVARSVDIQETQETQARTSADKRIIVTDKGYHCTV-CNKDFRSRTQQYYHLTC 93
            ||...:.:|...:..|  ::...|..|.:..:|.   |..|.:...: |...     |:.:|...
Mouse   337 CLQESLGECFSEKDPR--EVPGLQSRQEQPISDP---VLGKNHEANLPCESH-----QKRFHRDA 391

  Fly    94 GNDLLKKFNCKECGRRF----ATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQE 154
                 |.:.|:||.|.|    :.|||.:.||   .|:|:..|..|.|.||:...|:.|.:.|..|
Mouse   392 -----KLYKCEECSRMFKHARSLSSHQRTHL---NKKSELLCITCQKIFKRVSDLRTHEIIHMSE 448

  Fly   155 KHL-CPICQKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNN 211
            |.. |..|:|.|..|::|..|..||:. .:.:.|.|||:.|:..:..::|||.:.:::
Mouse   449 KPFKCSTCEKSFSHKTNLKYHEMIHTG-EMPYVCSLCSRRFRQSSTYHRHLRNYHRSD 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 3/20 (15%)
C2H2 Zn finger 103..123 CDD:275368 10/23 (43%)
COG5048 <112..288 CDD:227381 34/101 (34%)
C2H2 Zn finger 131..151 CDD:275368 7/19 (37%)
Chordopox_A33R 151..>254 CDD:283591 20/62 (32%)
C2H2 Zn finger 158..178 CDD:275368 7/19 (37%)
C2H2 Zn finger 187..207 CDD:275368 8/19 (42%)
C2H2 Zn finger 216..236 CDD:275368
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..290 CDD:275368
Zscan4bNP_001172102.1 SCAN <51..117 CDD:295388
zf-C2H2 394..416 CDD:278523 8/21 (38%)
C2H2 Zn finger 396..416 CDD:275368 8/19 (42%)
C2H2 Zn finger 425..445 CDD:275368 7/19 (37%)
zf-H2C2_2 437..462 CDD:290200 9/24 (38%)
zf-CHCC <441..489 CDD:295045 17/48 (35%)
C2H2 Zn finger 453..473 CDD:275368 7/19 (37%)
C2H2 Zn finger 481..499 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.