powered by:
Protein Alignment CG42726 and ZSCAN18
DIOPT Version :9
Sequence 1: | NP_732017.3 |
Gene: | CG42726 / 318709 |
FlyBaseID: | FBgn0261679 |
Length: | 441 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001139014.1 |
Gene: | ZSCAN18 / 65982 |
HGNCID: | 21037 |
Length: | 566 |
Species: | Homo sapiens |
Alignment Length: | 57 |
Identity: | 23/57 - (40%) |
Similarity: | 31/57 - (54%) |
Gaps: | 0/57 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 KKFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK 155
|.:.|.|||..||..|||..|..||..:.:::|..|.|:|...:.|..|..||.:||
Human 467 KPYACGECGEAFAWLSHLMEHHSSHGGRKRYACQGCWKTFHFSLALAEHQKTHEKEK 523
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23226 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.