DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and Zfp110

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001347505.1 Gene:Zfp110 / 65020 MGIID:1890378 Length:832 Species:Mus musculus


Alignment Length:178 Identity:51/178 - (28%)
Similarity:80/178 - (44%) Gaps:6/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 YYHLTCGNDLLKKFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHN 152
            ||.   |:|:.:......|.:.|:..:.....:..|:......||.|.|.|:.......|...|.
Mouse   650 YYR---GSDVGRLRRANNCRKAFSLHAQQISFIKIHKGSQVCRCSECGKLFRNARYFSVHKKIHT 711

  Fly   153 QEK-HLCPICQKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMC 216
            .|: ::|..|.|.|.:.|||..||.|||. ...|:|..|.:.|.:::.::||||.|......| |
Mouse   712 GERPYMCMACGKAFVQSSSLTQHLRIHSG-ERPFECSECGRTFNDRSAISQHLRTHTGAKPYH-C 774

  Fly   217 KVCQKSFLRQTTLRLHMKRHSNRERQSCSLCGKSYNDPDALGRHLRQH 264
            :.|.|:|.:.:.|..|.:.|:......|..|||::.....|..|.:.|
Mouse   775 ERCGKAFRQSSHLTRHERTHTGERPYVCIKCGKAFTQSSHLIGHQKTH 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 2/5 (40%)
C2H2 Zn finger 103..123 CDD:275368 2/19 (11%)
COG5048 <112..288 CDD:227381 45/154 (29%)
C2H2 Zn finger 131..151 CDD:275368 6/19 (32%)
Chordopox_A33R 151..>254 CDD:283591 35/103 (34%)
C2H2 Zn finger 158..178 CDD:275368 9/19 (47%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 6/19 (32%)
C2H2 Zn finger 272..290 CDD:275368
Zfp110NP_001347505.1 KRAB 18..77 CDD:214630
SCAN 159..246 CDD:307924
KRAB 283..324 CDD:307490
C2H2 Zn finger 663..682 CDD:275370 2/18 (11%)
C2H2 Zn finger 690..710 CDD:275368 6/19 (32%)
zf-H2C2_2 702..727 CDD:316026 7/24 (29%)
C2H2 Zn finger 718..738 CDD:275368 9/19 (47%)
zf-H2C2_2 730..754 CDD:316026 10/24 (42%)
C2H2 Zn finger 746..766 CDD:275368 7/19 (37%)
zf-C2H2 772..794 CDD:306579 7/22 (32%)
C2H2 Zn finger 774..794 CDD:275368 6/19 (32%)
zf-H2C2_2 786..811 CDD:316026 7/24 (29%)
C2H2 Zn finger 802..822 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.