DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42726 and ZSCAN5C

DIOPT Version :9

Sequence 1:	NP_732017.3	Gene:	CG42726 / 318709	FlyBaseID:	FBgn0261679	Length:	441	Species:	Drosophila melanogaster
Sequence 2:	NP_001345342.1	Gene:	ZSCAN5C / 649137	HGNCID:	34294	Length:	496	Species:	Homo sapiens

Alignment Length:	147	Identity:	60/147 - (40%)
Similarity:	74/147 - (50%)	Gaps:	5/147 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly    98 LKKFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPIC 161
            |..|.|:.||:||.....|..|..||..:....|::|.|.|.|.|.||.|..||..|: :.|.||
Human   353 LLPFACEVCGKRFKYRGKLAVHTRSHTGERLFQCNLCGKRFMQRIGLQFHQRTHTGERPYTCDIC 417

  Fly   162 QKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQ 226
            ||.|.:||.|..|...|:. ...|:|:.|.|.|..||||.:|.|.|.... .|.|..|.::|.|.
Human   418 QKQFTQKSYLKCHKRSHTG-EKPFECKDCKKVFTYKANLKEHQRIHSGEK-PHKCSKCPRAFGRP 480

  Fly   227 TTLRLHMKRHSNRERQS 243
            .|||.|.|.|  ||..|
Human   481 ATLRRHQKTH--REATS 495

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42726	NP_732017.3	C2H2 Zn finger	74..94	CDD:275368
		C2H2 Zn finger	103..123	CDD:275368	7/19 (37%)
		COG5048	<112..288	CDD:227381	53/133 (40%)
		C2H2 Zn finger	131..151	CDD:275368	9/19 (47%)
		Chordopox_A33R	151..>254	CDD:283591	39/94 (41%)
		C2H2 Zn finger	158..178	CDD:275368	10/19 (53%)
		C2H2 Zn finger	187..207	CDD:275368	10/19 (53%)
		C2H2 Zn finger	216..236	CDD:275368	9/19 (47%)
		C2H2 Zn finger	244..264	CDD:275368	60/147 (41%)
		C2H2 Zn finger	272..290	CDD:275368
ZSCAN5C	NP_001345342.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..38
		SCAN	40..124	CDD:153421
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	149..188
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	203..347
		zf-C2H2	356..378	CDD:333835	8/21 (38%)
		C2H2 Zn finger	358..378	CDD:275368	7/19 (37%)
		zf-H2C2_2	371..393	CDD:372612	7/21 (33%)
		C2H2 Zn finger	386..406	CDD:275368	9/19 (47%)
		COG5048	410..>473	CDD:227381	25/64 (39%)
		C2H2 Zn finger	414..434	CDD:275368	10/19 (53%)
		C2H2 Zn finger	442..462	CDD:275368	10/19 (53%)
		zf-C2H2	468..490	CDD:333835	10/21 (48%)
		C2H2 Zn finger	470..490	CDD:275368	9/19 (47%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23226
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100