DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and Zfp24

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001344376.1 Gene:Zfp24 / 59057 MGIID:1929704 Length:368 Species:Mus musculus


Alignment Length:121 Identity:38/121 - (31%)
Similarity:61/121 - (50%) Gaps:2/121 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 KKFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPICQ 162
            |:..|.|||:.|:..|.|..|...|..:..:.|..|.|:|.:..:|.:|...|..|| :.|..|.
Mouse   249 KQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECG 313

  Fly   163 KVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKV 218
            |.|.:.|.|.:|..||:. ...::|..|.|.:...:||.:|.|:|:...:.::.||
Mouse   314 KAFSQNSGLINHQRIHTG-EKPYECVQCGKSYSQSSNLFRHQRRHNAEKLLNVVKV 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 8/19 (42%)
COG5048 <112..288 CDD:227381 32/108 (30%)
C2H2 Zn finger 131..151 CDD:275368 6/19 (32%)
Chordopox_A33R 151..>254 CDD:283591 22/69 (32%)
C2H2 Zn finger 158..178 CDD:275368 7/19 (37%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368 2/3 (67%)
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..290 CDD:275368
Zfp24NP_001344376.1 SCAN 48..159 CDD:128708
COG5048 <249..329 CDD:227381 26/79 (33%)
Necessary and sufficient for nuclear localization. /evidence=ECO:0000250 251..301 15/49 (31%)
C2H2 Zn finger 253..273 CDD:275368 8/19 (42%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
COG5048 305..>358 CDD:227381 17/53 (32%)
C2H2 Zn finger 309..329 CDD:275368 7/19 (37%)
C2H2 Zn finger 337..357 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.