DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and zgc:113220

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_005170420.1 Gene:zgc:113220 / 568943 ZFINID:ZDB-GENE-050320-64 Length:516 Species:Danio rerio


Alignment Length:322 Identity:81/322 - (25%)
Similarity:133/322 - (41%) Gaps:43/322 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VSDCLECRVARSVDIQETQETQARTSADKRIIVTDKGYHCTVCNKDFRSRTQQYYHLTCGNDLLK 99
            :||...||:.:    :||:|.:.....:...:..|...:..:..::.:|.....:.:  ....:|
Zfish     1 MSDPEPCRIKQ----EETEEMEVMVKEESEELSDDDDKYHGIFEEETQSEIDHSFFM--NTTAVK 59

  Fly   100 KFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPICQK 163
            .|.|.:||:.|..:..|..|.|.|..:..:.||.|.|.|..|..|:.|...|..:| :.|..|.|
Zfish    60 GFICTQCGKSFRHNRDLVRHTMIHTGEKPYQCSHCDKRFNDPGYLKAHERIHTGDKPYHCIDCGK 124

  Fly   164 VFRRKSSLASHLAIHSDLGLQ-----------------------------FKCELCSKHFQNKAN 199
            .:.:.|||..|...:..|.::                             |.|.||.|.|..|..
Zfish   125 SYIQSSSLRMHRLKYHSLMMEESEALSEDEDKTQSKSEDGFLFNTAAVTGFICSLCGKSFNCKYY 189

  Fly   200 LNQHLRKHDKNNIRHMCKVCQKSFLRQTTLRLHMKRHSNRERQSCSLCGKSYNDPDALGRHLRQH 264
            ...|:..|.... .:.|..|.|:||:.:.|:.|::.|:|....||:.||||:.....|..|.:.|
Zfish   190 FKLHMMIHTGEK-PYKCDQCDKTFLKPSDLKSHIRVHTNERPYSCAECGKSFTHQLYLKAHEKIH 253

  Fly   265 KTAERYRCIQCDITINRKDNMLRHLRSMH----PGCAFASTVEMVTPR-SSAQEATTAEERP 321
            .....:.|.:||.|..|..|:.||.:: |    ||...:|::....|: ....:.|..||:|
Zfish   254 SGVREFACDKCDKTFLRAGNLKRHQKT-HAKDKPGIQSSSSMRFEQPQILKTHKGTRTEEKP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 1/19 (5%)
C2H2 Zn finger 103..123 CDD:275368 7/19 (37%)
COG5048 <112..288 CDD:227381 55/205 (27%)
C2H2 Zn finger 131..151 CDD:275368 8/19 (42%)
Chordopox_A33R 151..>254 CDD:283591 34/132 (26%)
C2H2 Zn finger 158..178 CDD:275368 7/19 (37%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368 7/19 (37%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
C2H2 Zn finger 272..290 CDD:275368 8/17 (47%)
zgc:113220XP_005170420.1 C2H2 Zn finger 63..83 CDD:275368 7/19 (37%)
zf-H2C2_2 75..99 CDD:290200 8/23 (35%)
COG5048 87..501 CDD:227381 62/230 (27%)
C2H2 Zn finger 91..111 CDD:275368 8/19 (42%)
C2H2 Zn finger 119..136 CDD:275368 6/16 (38%)
C2H2 Zn finger 177..197 CDD:275368 7/19 (37%)
zf-H2C2_2 189..212 CDD:290200 5/23 (22%)
C2H2 Zn finger 205..225 CDD:275368 7/19 (37%)
zf-H2C2_2 217..242 CDD:290200 10/24 (42%)
C2H2 Zn finger 233..253 CDD:275368 7/19 (37%)
C2H2 Zn finger 261..281 CDD:275368 8/20 (40%)
C2H2 Zn finger 373..393 CDD:275368
C2H2 Zn finger 401..421 CDD:275368
zf-H2C2_2 414..438 CDD:290200
C2H2 Zn finger 429..449 CDD:275368
C2H2 Zn finger 457..477 CDD:275368
zf-H2C2_2 470..492 CDD:290200
C2H2 Zn finger 485..505 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.