DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and ZNF83

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001099019.1 Gene:ZNF83 / 55769 HGNCID:13158 Length:516 Species:Homo sapiens


Alignment Length:301 Identity:84/301 - (27%)
Similarity:131/301 - (43%) Gaps:33/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KCPRCNCDATGQNRLVTDSCGHT-----KCRLCLVADVSDCLECRVARSVDIQETQETQARTSAD 62
            ||..|......::.|.:....||     ||..|                   .:.....:..:..
Human   122 KCDICGKIFNKKSNLASHQRIHTGEKPYKCNEC-------------------GKVFHNMSHLAQH 167

  Fly    63 KRIIVTDKGYHCTVCNKDFR--SRTQQYYHLTCGNDLLKKFNCKECGRRFATSSHLKYHLMSHEK 125
            :||...:|.|.|..|.|.|.  |...|:..:..|.   |.:.|.|||:.|...|||..|...|..
Human   168 RRIHTGEKPYKCNECGKVFNQISHLAQHQRIHTGE---KPYKCNECGKVFHQISHLAQHRTIHTG 229

  Fly   126 QSKHSCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPICQKVFRRKSSLASHLAIHSDLGLQFKCEL 189
            :..:.|:.|.|.|.:...|.:|::.|..|| :.|.:|.|||...|.||.|..||:. ...:||..
Human   230 EKPYECNKCGKVFSRNSYLVQHLIIHTGEKPYRCNVCGKVFHHISHLAQHQRIHTG-EKPYKCNE 293

  Fly   190 CSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQTTLRLHMKRHSNRERQSCSLCGKSYNDP 254
            |.|.|.:|::|..|.|.|.... .:.|..|.|.|..:::|..|.:.|:..:...|:.|||.::..
Human   294 CGKVFSHKSSLVNHWRIHTGEK-PYKCNECGKVFSHKSSLVNHWRIHTGEKPYKCNECGKVFSRN 357

  Fly   255 DALGRHLRQHKTAERYRCIQCDITINRKDNMLRHLRSMHPG 295
            ..|.:||..|...:.|:|.:||...::..::::|.| :|.|
Human   358 SYLAQHLIIHAGEKPYKCDECDKAFSQNSHLVQHHR-IHTG 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 6/21 (29%)
C2H2 Zn finger 103..123 CDD:275368 9/19 (47%)
COG5048 <112..288 CDD:227381 54/176 (31%)
C2H2 Zn finger 131..151 CDD:275368 6/19 (32%)
Chordopox_A33R 151..>254 CDD:283591 35/103 (34%)
C2H2 Zn finger 158..178 CDD:275368 9/19 (47%)
C2H2 Zn finger 187..207 CDD:275368 8/19 (42%)
C2H2 Zn finger 216..236 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
C2H2 Zn finger 272..290 CDD:275368 4/17 (24%)
ZNF83NP_001099019.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
C2H2 Zn finger 95..115 CDD:275368
COG5048 117..507 CDD:227381 84/301 (28%)
C2H2 Zn finger 123..143 CDD:275368 3/19 (16%)
C2H2 Zn finger 151..171 CDD:275368 3/38 (8%)
C2H2 Zn finger 179..199 CDD:275368 6/19 (32%)
C2H2 Zn finger 207..227 CDD:275368 9/19 (47%)
C2H2 Zn finger 235..255 CDD:275368 6/19 (32%)
C2H2 Zn finger 263..283 CDD:275368 9/19 (47%)
C2H2 Zn finger 291..311 CDD:275368 8/19 (42%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
C2H2 Zn finger 347..367 CDD:275368 7/19 (37%)
C2H2 Zn finger 375..395 CDD:275368 5/20 (25%)
C2H2 Zn finger 403..423 CDD:275368
C2H2 Zn finger 431..451 CDD:275368
C2H2 Zn finger 459..479 CDD:275368
C2H2 Zn finger 487..507 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.