DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and ZNF444

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_060807.2 Gene:ZNF444 / 55311 HGNCID:16052 Length:327 Species:Homo sapiens


Alignment Length:179 Identity:52/179 - (29%)
Similarity:70/179 - (39%) Gaps:46/179 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPICQKVFRRKSSLASHLAIHSDLGLQFKCELCSKH 193
            ||..|.|:..:|..|.||..:|:.|| |.||.|.|.||||    .||..|.|           .|
Human   180 SCPECGKTSLKPAHLLRHRQSHSGEKPHACPECGKAFRRK----EHLRRHRD-----------TH 229

  Fly   194 FQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQTTLRLHMKRHSNRERQSCSLCGKSYNDPDALG 258
            ..:..:....||........|.|  |:                          |||::...:.|.
Human   230 PGSPGSPGPALRPLPAREKPHAC--CE--------------------------CGKTFYWREHLV 266

  Fly   259 RHLRQHKTAERYRCIQCDITINRKDNMLRHLRSMHPGCAFASTVEMVTP 307
            ||.:.|..|..:.|.:|.....|::::|||.| :| |.|.||....|.|
Human   267 RHRKTHSGARPFACWECGKGFGRREHVLRHQR-IH-GRAAASAQGAVAP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368
COG5048 <112..288 CDD:227381 42/158 (27%)
C2H2 Zn finger 131..151 CDD:275368 7/19 (37%)
Chordopox_A33R 151..>254 CDD:283591 25/103 (24%)
C2H2 Zn finger 158..178 CDD:275368 10/19 (53%)
C2H2 Zn finger 187..207 CDD:275368 3/19 (16%)
C2H2 Zn finger 216..236 CDD:275368 2/19 (11%)
C2H2 Zn finger 244..264 CDD:275368 6/19 (32%)
C2H2 Zn finger 272..290 CDD:275368 6/17 (35%)
ZNF444NP_060807.2 SCAN 21..98 CDD:366881
PRK14959 <60..>182 CDD:184923 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..171
COG5048 <179..>280 CDD:227381 38/142 (27%)
C2H2 Zn finger 181..201 CDD:275368 7/19 (37%)
C2H2 Zn finger 209..229 CDD:275368 12/34 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..243 7/33 (21%)
C2H2 Zn finger 252..272 CDD:275368 8/47 (17%)
zf-C2H2 278..300 CDD:333835 7/22 (32%)
C2H2 Zn finger 280..300 CDD:275368 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.