DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and Zscan4d

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001093656.1 Gene:Zscan4d / 545913 MGIID:3645954 Length:506 Species:Mus musculus


Alignment Length:189 Identity:52/189 - (27%)
Similarity:83/189 - (43%) Gaps:26/189 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CLVADVSDCLECRVARSVDIQETQETQARTSADKRIIVTD--KGYHCTVCNKDFRSRTQQYYHLT 92
            ||...:.:|...:..|  ::...:..|....:|...:..|  ....|....|.||...       
Mouse   337 CLQESLGECFSEKDPR--ELPGLESRQEEPISDPVFLGKDHEANLPCESHQKRFRRDA------- 392

  Fly    93 CGNDLLKKFNCKECGRRF----ATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQ 153
                  |.|.|:||.|.|    :.|||.:.||   .|:|:..|..|.|.||:....:.|.:.|..
Mouse   393 ------KLFKCEECSRMFKHARSLSSHQRTHL---NKKSELLCVTCQKMFKRVSDRRTHEIIHMP 448

  Fly   154 EKHL-CPICQKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNN 211
            ||.. |..|:|.|..|::|.||..||:. .:.:.|.|||:.|:..:..::|||.:.:::
Mouse   449 EKPFKCSTCEKSFSHKTNLKSHEMIHTG-EMPYVCSLCSRRFRQSSTYHRHLRNYHRSD 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 4/19 (21%)
C2H2 Zn finger 103..123 CDD:275368 10/23 (43%)
COG5048 <112..288 CDD:227381 34/101 (34%)
C2H2 Zn finger 131..151 CDD:275368 6/19 (32%)
Chordopox_A33R 151..>254 CDD:283591 21/62 (34%)
C2H2 Zn finger 158..178 CDD:275368 8/19 (42%)
C2H2 Zn finger 187..207 CDD:275368 8/19 (42%)
C2H2 Zn finger 216..236 CDD:275368
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..290 CDD:275368
Zscan4dNP_001093656.1 SCAN <51..117 CDD:295388
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..264
zf-C2H2 395..417 CDD:278523 9/21 (43%)
C2H2 Zn finger 397..417 CDD:275368 8/19 (42%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
zf-H2C2_2 438..463 CDD:290200 8/24 (33%)
C2H2 Zn finger 454..474 CDD:275368 8/19 (42%)
zf-H2C2_2 466..491 CDD:290200 10/25 (40%)
C2H2 Zn finger 482..500 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.