DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and Zkscan6

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001289303.1 Gene:Zkscan6 / 52712 MGIID:1289293 Length:556 Species:Mus musculus


Alignment Length:162 Identity:42/162 - (25%)
Similarity:72/162 - (44%) Gaps:29/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 CKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEKHLCPICQKVFRR 167
            |:|||:.|..:|.|.:|..:|..::...|.:|.|:|.:.....:|..||..||.    |      
Mouse   417 CRECGKTFYRNSQLVFHQRTHTGETYFHCHICKKAFLRSSDFVKHQRTHTGEKP----C------ 471

  Fly   168 KSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQTTLRLH 232
                              ||:.|.|.|.:.:.|..|.:.|.... .:.|.:|:|||::::....|
Mouse   472 ------------------KCDYCGKGFSDFSGLRHHEKIHTGEK-PYKCPLCEKSFIQRSNFNRH 517

  Fly   233 MKRHSNRERQSCSLCGKSYNDPDALGRHLRQH 264
            .:.|:..:...|:.|||.::...:|.:|.|.|
Mouse   518 QRVHTGEKPYKCTHCGKQFSWSSSLDKHQRSH 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 8/19 (42%)
COG5048 <112..288 CDD:227381 37/153 (24%)
C2H2 Zn finger 131..151 CDD:275368 5/19 (26%)
Chordopox_A33R 151..>254 CDD:283591 23/102 (23%)
C2H2 Zn finger 158..178 CDD:275368 1/19 (5%)
C2H2 Zn finger 187..207 CDD:275368 6/19 (32%)
C2H2 Zn finger 216..236 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
C2H2 Zn finger 272..290 CDD:275368
Zkscan6NP_001289303.1 SCAN 37..144 CDD:383046
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..195
KRAB_A-box 229..278 CDD:383038
C2H2 Zn finger 417..437 CDD:275368 8/19 (42%)
COG5048 <428..541 CDD:227381 33/141 (23%)
C2H2 Zn finger 445..465 CDD:275368 5/19 (26%)
C2H2 Zn finger 473..493 CDD:275368 6/19 (32%)
C2H2 Zn finger 501..521 CDD:275368 6/19 (32%)
C2H2 Zn finger 529..549 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.