DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and trem

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster


Alignment Length:230 Identity:52/230 - (22%)
Similarity:80/230 - (34%) Gaps:66/230 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LKKFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEKHLCPICQ 162
            |..:.|..||..:.|.:.|..|:..|.....|.|.:|.:.|.|...|.|||.||...:       
  Fly   269 LSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECEICGRGFVQNQQLVRHMNTHTGNR------- 326

  Fly   163 KVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQT 227
                                 .:||..|...|.:::...:|.|.|.|.. .::|.||.::|....
  Fly   327 ---------------------PYKCNYCPAAFADRSTKTKHHRIHTKER-PYVCDVCSRTFTYSD 369

  Fly   228 TLRLHMKRHSNRERQSCSLCGKSYNDPDALGRHLRQHKTAERYRCIQCDITINRKDNMLRHLRSM 292
            .|:.|...|:..:...|.||||.:.....|..|...|               ||:          
  Fly   370 NLKFHKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETH---------------NRR---------- 409

  Fly   293 HPGCAFASTVEMVTPRSSAQEATTAEERPSQTVRY 327
                        :|.|:.|:|:|.||:...:|..:
  Fly   410 ------------ITWRNDAEESTKAEDVKGETPEF 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 6/19 (32%)
COG5048 <112..288 CDD:227381 40/175 (23%)
C2H2 Zn finger 131..151 CDD:275368 8/19 (42%)
Chordopox_A33R 151..>254 CDD:283591 21/102 (21%)
C2H2 Zn finger 158..178 CDD:275368 0/19 (0%)
C2H2 Zn finger 187..207 CDD:275368 5/19 (26%)
C2H2 Zn finger 216..236 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
C2H2 Zn finger 272..290 CDD:275368 2/17 (12%)
tremNP_650861.1 zf-AD 11..87 CDD:214871
COG5048 <264..411 CDD:227381 44/207 (21%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
zf-H2C2_2 287..311 CDD:290200 7/23 (30%)
C2H2 Zn finger 302..322 CDD:275368 8/19 (42%)
zf-H2C2_2 315..338 CDD:290200 9/50 (18%)
C2H2 Zn finger 330..350 CDD:275368 5/19 (26%)
zf-H2C2_2 345..367 CDD:290200 8/22 (36%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
zf-H2C2_2 370..394 CDD:290200 8/23 (35%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.