DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and gl

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001262708.1 Gene:gl / 42210 FlyBaseID:FBgn0004618 Length:679 Species:Drosophila melanogaster


Alignment Length:144 Identity:50/144 - (34%)
Similarity:74/144 - (51%) Gaps:3/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 CKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEKHL-CPICQKVFR 166
            |:.||:.:|..|.||.||.:|..:..:.|..|:|||.|...|..|:.||..:|.. ||||.:.|.
  Fly   439 CRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFS 503

  Fly   167 RKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQTTLRL 231
            :.||:.:|:..||. ...::|..|.|.|.:.:.|.:|||.|.... .:.||:|...|.:...|..
  Fly   504 QSSSVTTHMRTHSG-ERPYRCSSCKKSFSDSSTLTKHLRIHSGEK-PYQCKLCLLRFSQSGNLNR 566

  Fly   232 HMKRHSNRERQSCS 245
            ||:.|.|....:.|
  Fly   567 HMRVHGNNNSSNGS 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 9/19 (47%)
COG5048 <112..288 CDD:227381 46/135 (34%)
C2H2 Zn finger 131..151 CDD:275368 8/19 (42%)
Chordopox_A33R 151..>254 CDD:283591 31/96 (32%)
C2H2 Zn finger 158..178 CDD:275368 8/19 (42%)
C2H2 Zn finger 187..207 CDD:275368 8/19 (42%)
C2H2 Zn finger 216..236 CDD:275368 7/19 (37%)
C2H2 Zn finger 244..264 CDD:275368 1/2 (50%)
C2H2 Zn finger 272..290 CDD:275368
glNP_001262708.1 C2H2 Zn finger 439..459 CDD:275368 9/19 (47%)
zf-C2H2 439..459 CDD:278523 9/19 (47%)
zf-H2C2_2 452..476 CDD:290200 10/23 (43%)
C2H2 Zn finger 467..487 CDD:275368 8/19 (42%)
zf-H2C2_2 479..504 CDD:290200 10/24 (42%)
zf-C2H2_8 492..570 CDD:292531 26/79 (33%)
C2H2 Zn finger 495..515 CDD:275368 8/19 (42%)
zf-H2C2_2 507..531 CDD:290200 7/24 (29%)
C2H2 Zn finger 523..543 CDD:275368 8/19 (42%)
zf-H2C2_2 536..560 CDD:290200 9/24 (38%)
C2H2 Zn finger 551..571 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.