DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and CG6813

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster


Alignment Length:297 Identity:66/297 - (22%)
Similarity:106/297 - (35%) Gaps:57/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CRLCLVADVSDCLECRVARSVDI----------QETQETQARTSADKRIIVTDKGYHCTVCNKD- 80
            ||:|..:|.          .:|:          |....|....|..|.|    .|..||.|..: 
  Fly     6 CRICSRSDA----------PIDLFGPGNGHLVRQIHSITGVELSCKKEI----SGQMCTTCLDNL 56

  Fly    81 -----FRSRTQQYYHLTCGNDLLKKFNC--KECGRRFATSSHLKYHLMSHEKQSKHSCSV-CHKS 137
                 ||.|.     :......|::..|  |:|    :|...:...:..::.:|:...|: |.:.
  Fly    57 QAAIKFRQRC-----IIAEKQNLERIECDSKDC----STDPIIYEDIDDNQIESELDESILCPEV 112

  Fly   138 FKQPI-----VLQRHMLTHNQE------KHLCPICQKVFRRKSSLASHLAIHSDLGLQFKCEL-- 189
            ...|:     |.....|.|.:.      .::||.|.::...||:...|...|:.: ..|.|..  
  Fly   113 KDLPMPSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGI-KNFHCVFLN 176

  Fly   190 CSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQTTLRLHMKRHSNRERQSCSLCGKSYNDP 254
            |.:.|..:..|..|.|.|.... .::|..|.:.|......:.|.:||.|..|..|..|.||:...
  Fly   177 CERSFATRKELTSHTRIHTGEQ-PYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSS 240

  Fly   255 DALGRHLRQHKTAERYRCIQCDITINRKDNMLRHLRS 291
            ..|.:|...|..|..:.|..|.....|..:::.||.|
  Fly   241 GCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 6/25 (24%)
C2H2 Zn finger 103..123 CDD:275368 4/21 (19%)
COG5048 <112..288 CDD:227381 42/189 (22%)
C2H2 Zn finger 131..151 CDD:275368 5/25 (20%)
Chordopox_A33R 151..>254 CDD:283591 28/110 (25%)
C2H2 Zn finger 158..178 CDD:275368 6/19 (32%)
C2H2 Zn finger 187..207 CDD:275368 6/21 (29%)
C2H2 Zn finger 216..236 CDD:275368 4/19 (21%)
C2H2 Zn finger 244..264 CDD:275368 6/19 (32%)
C2H2 Zn finger 272..290 CDD:275368 4/17 (24%)
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 18/88 (20%)
C2H2 Zn finger 144..164 CDD:275368 6/19 (32%)
C2H2 Zn finger 172..194 CDD:275368 6/21 (29%)
zf-H2C2_2 186..211 CDD:290200 7/25 (28%)
UFD2 <256..>294 CDD:227443 6/22 (27%)
C2H2 Zn finger 258..280 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.