DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and Zfp174

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001074686.1 Gene:Zfp174 / 385674 MGIID:2686600 Length:407 Species:Mus musculus


Alignment Length:172 Identity:46/172 - (26%)
Similarity:73/172 - (42%) Gaps:25/172 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ETQARTSADKRII------------VTDKGYHCTVCNKDFRSRTQQYYHLTCGNDLLKKFNCKEC 106
            |.:..|::|.|::            :.....||         |..:|.........|::......
Mouse   246 EPRGVTASDARLLQWQVRPPQSPKSLAHYQKHC---------RELEYISNPLRGHPLRELKRSRG 301

  Fly   107 GRRFATSSHLKY--HLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPICQKVFRRK 168
            |||.:.|..|:.  |..:|..:..:||..|.|:|.....|:||...|..|: ::|..|...|.|:
Mouse   302 GRRRSLSGLLQCLGHQAAHPAKKPYSCEDCGKNFTWNSELKRHRRVHTGERPYICGECGNCFGRQ 366

  Fly   169 SSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKN 210
            |:|..|..||:. ...::|..|.|.|:..:||:||.|.|..|
Mouse   367 STLKLHQRIHTG-EKPYQCSHCGKCFRQSSNLHQHHRLHHGN 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 3/19 (16%)
C2H2 Zn finger 103..123 CDD:275368 6/21 (29%)
COG5048 <112..288 CDD:227381 34/102 (33%)
C2H2 Zn finger 131..151 CDD:275368 7/19 (37%)
Chordopox_A33R 151..>254 CDD:283591 22/61 (36%)
C2H2 Zn finger 158..178 CDD:275368 7/19 (37%)
C2H2 Zn finger 187..207 CDD:275368 9/19 (47%)
C2H2 Zn finger 216..236 CDD:275368
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..290 CDD:275368
Zfp174NP_001074686.1 SCAN 42..152 CDD:128708
SCAN 42..130 CDD:280241
C2H2 Zn finger 328..348 CDD:275368 7/19 (37%)
zf-H2C2_2 340..365 CDD:290200 8/24 (33%)
COG5048 352..>407 CDD:227381 19/55 (35%)
C2H2 Zn finger 356..376 CDD:275368 7/19 (37%)
zf-H2C2_2 369..393 CDD:290200 8/24 (33%)
C2H2 Zn finger 384..404 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.