DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and CG12605

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster


Alignment Length:177 Identity:57/177 - (32%)
Similarity:88/177 - (49%) Gaps:17/177 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 HLTCGN--DLLKK----FNCKECGRRFATSSHLKYHLMSH---EKQSKHSCSVCHKSFKQPIVLQ 145
            |.:.||  :..|:    :.|.|||:::||||:|..|..:|   :.||...|:.|.|::.....|.
  Fly   422 HSSSGNGENYAKRKRGCYKCCECGKQYATSSNLSRHKQTHRSLDSQSAKKCNTCGKAYVSMPALA 486

  Fly   146 RHMLTHNQEKHLCPICQKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKH--D 208
            .|:||| :..|.|.||.|:|.|...|..||..|:. ...:.|..|.|.|.:::||..|::.|  |
  Fly   487 MHLLTH-KLSHSCDICGKLFSRPWLLQGHLRSHTG-EKPYACVHCGKAFADRSNLRAHMQTHSGD 549

  Fly   209 KNNIRHMCKVCQKSFLRQTTLRLHMKRHSNRERQSCSLCGKSYNDPD 255
            ||   ..|..|.|:|..::.|..|::....|:..:... ||...:.|
  Fly   550 KN---FKCHRCNKTFALKSYLNKHLESACLRDAGAIDQ-GKGLEEED 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 1/3 (33%)
C2H2 Zn finger 103..123 CDD:275368 10/19 (53%)
COG5048 <112..288 CDD:227381 48/149 (32%)
C2H2 Zn finger 131..151 CDD:275368 6/19 (32%)
Chordopox_A33R 151..>254 CDD:283591 32/104 (31%)
C2H2 Zn finger 158..178 CDD:275368 9/19 (47%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 3/12 (25%)
C2H2 Zn finger 272..290 CDD:275368
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 10/21 (48%)
C2H2 Zn finger 441..461 CDD:275370 10/19 (53%)
C2H2 Zn finger 472..492 CDD:275368 6/19 (32%)
COG5048 492..>570 CDD:227381 28/82 (34%)
zf-C2H2 496..518 CDD:278523 10/21 (48%)
C2H2 Zn finger 498..518 CDD:275368 9/19 (47%)
zf-H2C2_2 511..534 CDD:290200 7/23 (30%)
zf-C2H2 524..546 CDD:278523 7/21 (33%)
C2H2 Zn finger 526..546 CDD:275368 7/19 (37%)
zf-H2C2_2 538..562 CDD:290200 10/26 (38%)
C2H2 Zn finger 554..571 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457103
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.