DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and CG11906

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_611402.2 Gene:CG11906 / 37209 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster


Alignment Length:214 Identity:54/214 - (25%)
Similarity:83/214 - (38%) Gaps:39/214 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LKKFNC--KECGRRFAT-SSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEKHLCP 159
            ||.|.|  .:||.:..| .:.:|:..|.|.|.|...|..|...|...:.|..||...|:..::|.
  Fly   441 LKSFTCFTPDCGYQTDTLVALMKHDYMEHWKMSWFYCHKCGDVFTSKVFLDYHMHLQNRGLYICH 505

  Fly   160 ICQKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRK--HDKNNIRHMCKVCQKS 222
            .|::.|..:..|..|..:|.. |:.:.|..|...|.::|.|..|.:|  |..|: ..:..: .:|
  Fly   506 KCREEFELQHQLDRHFQLHRK-GINYHCNFCRLEFLSEAKLLAHCKKLGHSPND-EPLISI-DRS 567

  Fly   223 FLRQTTLRLHMKRHSNRERQSCSLCGKSYND----------PDALGRHLRQHKTAERYRCIQCDI 277
            .   :.:..|:.|.|:..|     ..|||.:          |.....||.|||.. |:....|| 
  Fly   568 L---SIVNCHVPRSSDYSR-----IVKSYEEREFYIPRIPMPSTQPMHLPQHKPF-RFAIGICD- 622

  Fly   278 TINRKDNMLRHLRSMHPGC 296
                       ....:|.|
  Fly   623 -----------FEERNPNC 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 6/22 (27%)
COG5048 <112..288 CDD:227381 46/188 (24%)
C2H2 Zn finger 131..151 CDD:275368 6/19 (32%)
Chordopox_A33R 151..>254 CDD:283591 25/114 (22%)
C2H2 Zn finger 158..178 CDD:275368 5/19 (26%)
C2H2 Zn finger 187..207 CDD:275368 7/21 (33%)
C2H2 Zn finger 216..236 CDD:275368 2/19 (11%)
C2H2 Zn finger 244..264 CDD:275368 6/29 (21%)
C2H2 Zn finger 272..290 CDD:275368 2/17 (12%)
CG11906NP_611402.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468400
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.