DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42726 and Zfp24

DIOPT Version :9

Sequence 1:	NP_732017.3	Gene:	CG42726 / 318709	FlyBaseID:	FBgn0261679	Length:	441	Species:	Drosophila melanogaster
Sequence 2:	NP_892000.1	Gene:	Zfp24 / 360204	RGDID:	727963	Length:	368	Species:	Rattus norvegicus

Alignment Length:	121	Identity:	38/121 - (31%)
Similarity:	61/121 - (50%)	Gaps:	2/121 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    99 KKFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPICQ 162
            |:..|.|||:.|:..|.|..|...|..:..:.|..|.|:|.:..:|.:|...|..|| :.|..|.
  Rat   249 KQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECG 313

  Fly   163 KVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKV 218
            |.|.:.|.|.:|..||:. ...::|..|.|.:...:||.:|.|:|:...:.::.||
  Rat   314 KAFSQNSGLINHQRIHTG-EKPYECVQCGKSYSQSSNLFRHQRRHNAEKLLNVVKV 368

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42726	NP_732017.3	C2H2 Zn finger	74..94	CDD:275368
		C2H2 Zn finger	103..123	CDD:275368	8/19 (42%)
		COG5048	<112..288	CDD:227381	32/108 (30%)
		C2H2 Zn finger	131..151	CDD:275368	6/19 (32%)
		Chordopox_A33R	151..>254	CDD:283591	22/69 (32%)
		C2H2 Zn finger	158..178	CDD:275368	7/19 (37%)
		C2H2 Zn finger	187..207	CDD:275368	7/19 (37%)
		C2H2 Zn finger	216..236	CDD:275368	2/3 (67%)
		C2H2 Zn finger	244..264	CDD:275368
		C2H2 Zn finger	272..290	CDD:275368
Zfp24	NP_892000.1	SCAN	48..159	CDD:128708
		SCAN	48..136	CDD:280241
		CdhC	<101..173	CDD:299819
		COG5048	<249..329	CDD:227381	26/79 (33%)
		Necessary and sufficient for nuclear localization. /evidence=ECO:0000250	251..301		15/49 (31%)
		zf-C2H2	251..273	CDD:278523	8/21 (38%)
		C2H2 Zn finger	253..273	CDD:275368	8/19 (42%)
		zf-H2C2_2	269..290	CDD:290200	6/20 (30%)
		C2H2 Zn finger	281..301	CDD:275368	6/19 (32%)
		zf-H2C2_2	294..318	CDD:290200	9/23 (39%)
		COG5048	305..>358	CDD:227381	17/53 (32%)
		C2H2 Zn finger	309..329	CDD:275368	7/19 (37%)
		zf-H2C2_2	322..346	CDD:290200	7/24 (29%)
		C2H2 Zn finger	337..357	CDD:275368	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23226
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100