DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and esg

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster


Alignment Length:213 Identity:66/213 - (30%)
Similarity:102/213 - (47%) Gaps:32/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PRCNCDATGQNRLVTDSCGHTKCRLCLVADVSDCLECRVARSVDIQETQETQARTSADKRIIVTD 69
            |..:|.::....|   |..|....|.|  :.|...|...|::.|:  :.||....||.|     |
  Fly   250 PESSCSSSLPEDL---SLKHKNLNLNL--NTSQPGEQAAAKTGDM--SPETMPNASAKK-----D 302

  Fly    70 KG----YHCTVCNKDFR-----SRTQQYYHLTC----GNDLLKKFNCKECGRRFATSSHLKYHLM 121
            |.    |.|..|.|.:.     ::.||::   |    ||.:.|.|:||:|.:.:.:...||.|:.
  Fly   303 KNQPPRYQCPDCQKSYSTFSGLTKHQQFH---CPAAEGNQVKKSFSCKDCDKTYVSLGALKMHIR 364

  Fly   122 SHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEKHL-CPICQKVFRRKSSLASHLAIHSDLGLQF 185
            :|....|  |::|.|:|.:|.:||.|:.||..||.. |..|.:.|..:|:|.:||..|||: .::
  Fly   365 THTLPCK--CNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHSDI-KKY 426

  Fly   186 KCELCSKHFQNKANLNQH 203
            .|..|||.|...:.|.:|
  Fly   427 SCTSCSKTFSRMSLLTKH 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 6/28 (21%)
C2H2 Zn finger 103..123 CDD:275368 6/19 (32%)
COG5048 <112..288 CDD:227381 34/93 (37%)
C2H2 Zn finger 131..151 CDD:275368 8/19 (42%)
Chordopox_A33R 151..>254 CDD:283591 20/54 (37%)
C2H2 Zn finger 158..178 CDD:275368 7/19 (37%)
C2H2 Zn finger 187..207 CDD:275368 7/17 (41%)
C2H2 Zn finger 216..236 CDD:275368
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..290 CDD:275368
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 6/21 (29%)
C2H2 Zn finger 311..331 CDD:275370 5/19 (26%)
zf-C2H2 344..366 CDD:278523 7/21 (33%)
C2H2 Zn finger 346..366 CDD:275368 6/19 (32%)
zf-C2H2 370..392 CDD:278523 9/23 (39%)
C2H2 Zn finger 372..392 CDD:275368 8/19 (42%)
zf-H2C2_2 385..408 CDD:290200 9/22 (41%)
zf-C2H2 398..420 CDD:278523 7/21 (33%)
C2H2 Zn finger 400..420 CDD:275368 7/19 (37%)
C2H2 Zn finger 428..444 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.