DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42726 and ZSCAN5B

DIOPT Version :9

Sequence 1:	NP_732017.3	Gene:	CG42726 / 318709	FlyBaseID:	FBgn0261679	Length:	441	Species:	Drosophila melanogaster
Sequence 2:	NP_001073925.2	Gene:	ZSCAN5B / 342933	HGNCID:	34246	Length:	495	Species:	Homo sapiens

Alignment Length:	147	Identity:	56/147 - (38%)
Similarity:	73/147 - (49%)	Gaps:	5/147 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly    98 LKKFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPIC 161
            |..|.|..|.:.|...|.|..|..||.......|.:|.|.|.||..|:.|...|..|: ::|.:|
Human   352 LPPFACDVCNKSFKYFSQLSIHRRSHTGDRPFQCDLCRKRFLQPSDLRVHQRVHTGERPYMCDVC 416

  Fly   162 QKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQ 226
            ||.|..:|:|..|..||:. ...|||:.|||.|.:|.|||.|.|.|.... .:.|..|||:|.:.
Human   417 QKRFAHESTLQGHKRIHTG-ERPFKCKYCSKVFSHKGNLNVHQRTHSGEK-PYKCPTCQKAFRQL 479

  Fly   227 TTLRLHMKRHSNRERQS 243
            .|.:.|:|.|  ||..|
Human   480 GTFKRHLKTH--RETTS 494

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42726	NP_732017.3	C2H2 Zn finger	74..94	CDD:275368
		C2H2 Zn finger	103..123	CDD:275368	6/19 (32%)
		COG5048	<112..288	CDD:227381	51/133 (38%)
		C2H2 Zn finger	131..151	CDD:275368	8/19 (42%)
		Chordopox_A33R	151..>254	CDD:283591	38/94 (40%)
		C2H2 Zn finger	158..178	CDD:275368	8/19 (42%)
		C2H2 Zn finger	187..207	CDD:275368	11/19 (58%)
		C2H2 Zn finger	216..236	CDD:275368	8/19 (42%)
		C2H2 Zn finger	244..264	CDD:275368	56/147 (38%)
		C2H2 Zn finger	272..290	CDD:275368
ZSCAN5B	NP_001073925.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..40
		SCAN	40..124	CDD:153421
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	150..183
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	227..347
		zf-C2H2	355..377	CDD:395048	7/21 (33%)
		C2H2 Zn finger	357..377	CDD:275368	6/19 (32%)
		zf-H2C2_2	370..394	CDD:404364	8/23 (35%)
		C2H2 Zn finger	385..405	CDD:275368	8/19 (42%)
		C2H2 Zn finger	413..433	CDD:275368	8/19 (42%)
		zf-H2C2_2	426..450	CDD:404364	11/24 (46%)
		C2H2 Zn finger	441..461	CDD:275368	11/19 (58%)
		zf-H2C2_2	453..478	CDD:404364	11/25 (44%)
		C2H2 Zn finger	469..489	CDD:275368	8/19 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23226
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100