DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and wu:fc30c06

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001314845.1 Gene:wu:fc30c06 / 324469 ZFINID:ZDB-GENE-030131-3190 Length:424 Species:Danio rerio


Alignment Length:319 Identity:89/319 - (27%)
Similarity:131/319 - (41%) Gaps:48/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KCPRCNCDATGQNRLVTDSCGHTKCRLCLVADVSDCLECRVARSVDIQETQETQARTSADKRIIV 67
            :|.:|....|.:..|......|:..:..|      |.:|.:        |...:...:...||..
Zfish   121 RCSQCGLSFTRKQTLNGHMSIHSGVKPYL------CAQCGL--------TFSYRKNLNLHMRIHT 171

  Fly    68 TDKGYHCTVCNKDFRSR------------TQQYYHLTCGNDLLKK--FN-------------CKE 105
            .:|.|.||.|...||.:            .:.|....||.....|  ||             |.:
Zfish   172 GEKPYSCTRCELSFRKKQCLKIHMRIHTGEKPYLCAQCGLSFTHKQTFNSHTRNHTGEKPHTCAQ 236

  Fly   106 CGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPICQKVFRRKS 169
            ||..|||...|:.|...|..:..:.||.|...|.....|..|..:|..|| ::|..|...|.||.
Zfish   237 CGSSFATKQSLRIHTRIHTGEKPYMCSQCGIGFTHKNALNVHFTSHTGEKPYICHQCGSGFTRKH 301

  Fly   170 SLASHLAIHSDLGLQ-FKCELCSKHFQNKANLNQHLRKHDKNNIR-HMCKVCQKSFLRQTTLRLH 232
            :|.:||.||:  |.: .||..|...|..|..||.|:|.|  |.:: :.|..|.:||..:.||.:|
Zfish   302 ALNTHLVIHT--GQKPHKCSECGLSFTKKTALNSHVRIH--NAVKPYTCSHCGQSFKHKQTLNIH 362

  Fly   233 MKRHSNRERQSCSLCGKSYNDPDALGRHLRQHKTAERYRCIQCDITINRKDNMLRHLRS 291
            .:.|:..:..||:.||:|:.....|..|||.|...:.|.|.||.::...:..:..|:||
Zfish   363 RRVHTGEKPYSCTQCGQSFPHKQTLRSHLRIHTGEKAYACSQCGMSFMYRRGLNVHVRS 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 6/31 (19%)
C2H2 Zn finger 103..123 CDD:275368 8/19 (42%)
COG5048 <112..288 CDD:227381 57/178 (32%)
C2H2 Zn finger 131..151 CDD:275368 6/19 (32%)
Chordopox_A33R 151..>254 CDD:283591 38/105 (36%)
C2H2 Zn finger 158..178 CDD:275368 8/19 (42%)
C2H2 Zn finger 187..207 CDD:275368 8/19 (42%)
C2H2 Zn finger 216..236 CDD:275368 7/19 (37%)
C2H2 Zn finger 244..264 CDD:275368 8/19 (42%)
C2H2 Zn finger 272..290 CDD:275368 4/17 (24%)
wu:fc30c06NP_001314845.1 C2H2 Zn finger 94..114 CDD:275368
zf-H2C2_2 106..131 CDD:290200 2/9 (22%)
C2H2 Zn finger 122..142 CDD:275368 4/19 (21%)
COG5048 146..>390 CDD:227381 73/261 (28%)
C2H2 Zn finger 150..170 CDD:275368 4/27 (15%)
C2H2 Zn finger 178..198 CDD:275368 5/19 (26%)
zf-H2C2_2 191..215 CDD:290200 3/23 (13%)
C2H2 Zn finger 206..226 CDD:275368 5/19 (26%)
C2H2 Zn finger 234..254 CDD:275368 8/19 (42%)
zf-H2C2_2 246..271 CDD:290200 7/24 (29%)
C2H2 Zn finger 262..282 CDD:275368 6/19 (32%)
C2H2 Zn finger 290..310 CDD:275368 8/19 (42%)
C2H2 Zn finger 318..338 CDD:275368 8/19 (42%)
C2H2 Zn finger 346..366 CDD:275368 7/19 (37%)
zf-H2C2_2 359..381 CDD:290200 7/21 (33%)
C2H2 Zn finger 374..394 CDD:275368 8/19 (42%)
C2H2 Zn finger 402..422 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.