DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42726 and Zscan5b

DIOPT Version :9

Sequence 1:	NP_732017.3	Gene:	CG42726 / 318709	FlyBaseID:	FBgn0261679	Length:	441	Species:	Drosophila melanogaster
Sequence 2:	XP_218239.6	Gene:	Zscan5b / 292566	RGDID:	1559143	Length:	484	Species:	Rattus norvegicus

Alignment Length:	144	Identity:	50/144 - (34%)
Similarity:	75/144 - (52%)	Gaps:	5/144 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   100 KFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPICQK 163
            :|.|.:|.:.|...||...|..||..:....|::|:|:|.||..|:.|...|..|| :.|.:|.|
  Rat   331 QFQCPQCKKSFLYKSHFTLHWRSHTGERPFKCNLCNKAFLQPSDLRVHRRVHTGEKPYSCEVCGK 395

  Fly   164 VFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIR-HMCKVCQKSFLRQT 227
            .|...|:|..|..:|:. ...:.||.|.:.|.:|.||..|.|.|  ..:| ::||.|.|:|.:|.
  Rat   396 EFAHGSTLQGHSRVHTK-EKPYVCENCGQCFSHKGNLTVHFRIH--CGLRPYICKKCNKAFRQQG 457

  Fly   228 TLRLHMKRHSNRER 241
            |.:.|||.|..:.:
  Rat   458 TWKRHMKTHWKKRK 471

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42726	NP_732017.3	C2H2 Zn finger	74..94	CDD:275368
		C2H2 Zn finger	103..123	CDD:275368	6/19 (32%)
		COG5048	<112..288	CDD:227381	46/132 (35%)
		C2H2 Zn finger	131..151	CDD:275368	8/19 (42%)
		Chordopox_A33R	151..>254	CDD:283591	33/93 (35%)
		C2H2 Zn finger	158..178	CDD:275368	7/19 (37%)
		C2H2 Zn finger	187..207	CDD:275368	9/19 (47%)
		C2H2 Zn finger	216..236	CDD:275368	10/19 (53%)
		C2H2 Zn finger	244..264	CDD:275368
		C2H2 Zn finger	272..290	CDD:275368
Zscan5b	XP_218239.6	SCAN	33..112	CDD:153421
		COG5048	<261..>432	CDD:227381	34/101 (34%)
		C2H2 Zn finger	334..354	CDD:275368	6/19 (32%)
		SFP1	<356..411	CDD:227516	18/54 (33%)
		C2H2 Zn finger	362..382	CDD:275368	8/19 (42%)
		zf-H2C2_2	374..399	CDD:404364	9/24 (38%)
		C2H2 Zn finger	390..410	CDD:275368	7/19 (37%)
		zf-C2H2	416..438	CDD:395048	9/21 (43%)
		C2H2 Zn finger	418..438	CDD:275368	9/19 (47%)
		zf-C2H2	444..466	CDD:395048	10/21 (48%)
		C2H2 Zn finger	446..466	CDD:275368	10/19 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23226
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100