Sequence 1: | NP_732017.3 | Gene: | CG42726 / 318709 | FlyBaseID: | FBgn0261679 | Length: | 441 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038952138.1 | Gene: | Zkscan4 / 291164 | RGDID: | 1309004 | Length: | 480 | Species: | Rattus norvegicus |
Alignment Length: | 259 | Identity: | 71/259 - (27%) |
---|---|---|---|
Similarity: | 106/259 - (40%) | Gaps: | 42/259 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 DCLECRVARSVDIQE--TQETQARTSADKRIIVTDKGYHCTVCNKDF--RSRTQQYYHLTCGNDL 97
Fly 98 LKKFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPIC 161
Fly 162 QKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKH-DKNNIR------------ 213
Fly 214 -------------HMCKVCQKSFLRQTTLRLHMKRHSNRERQSCSLCGKSYNDPDALGRHLRQH 264 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42726 | NP_732017.3 | C2H2 Zn finger | 74..94 | CDD:275368 | 5/21 (24%) |
C2H2 Zn finger | 103..123 | CDD:275368 | 8/19 (42%) | ||
COG5048 | <112..288 | CDD:227381 | 53/180 (29%) | ||
C2H2 Zn finger | 131..151 | CDD:275368 | 6/19 (32%) | ||
Chordopox_A33R | 151..>254 | CDD:283591 | 37/129 (29%) | ||
C2H2 Zn finger | 158..178 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 187..207 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 216..236 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 244..264 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 272..290 | CDD:275368 | |||
Zkscan4 | XP_038952138.1 | SCAN | 47..156 | CDD:128708 | |
zf-C2H2 | 253..275 | CDD:395048 | 5/21 (24%) | ||
C2H2 Zn finger | 255..275 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 268..290 | CDD:404364 | 5/24 (21%) | ||
zf-C2H2 | 281..303 | CDD:395048 | 8/21 (38%) | ||
C2H2 Zn finger | 283..303 | CDD:275368 | 8/19 (42%) | ||
COG5048 | <307..471 | CDD:227381 | 48/165 (29%) | ||
C2H2 Zn finger | 311..331 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 339..359 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 367..387 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 422..442 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 450..470 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23226 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |