DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and Zfp13

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001382483.1 Gene:Zfp13 / 287095 RGDID:1304577 Length:538 Species:Rattus norvegicus


Alignment Length:282 Identity:81/282 - (28%)
Similarity:127/282 - (45%) Gaps:33/282 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TQETQARTSADKRIIV-TDKG---YHCTVCNKDF----------RSRTQQYYHLTCGNDLLKKFN 102
            ::..:|.||.::.::. :|.|   |.|..|.|.|          |:.|.:           |.:.
  Rat   268 SEREEALTSGEESLVPDSDTGKKTYKCEQCGKGFSWHSHLVTHRRTHTGE-----------KPYT 321

  Fly   103 CKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPICQKVFR 166
            |.:||:||..||||..|.:.|..:..::|..|.|||.....|.:|...|..|| ::|..|.|.|.
  Rat   322 CTDCGKRFGRSSHLIQHQIIHTGEKPYTCPSCWKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFT 386

  Fly   167 RKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIR-HMCKVCQKSFLRQTTLR 230
            |:|.|.:|...|:. ....||.:|.|.|...:.|..|.|.|  ..:: :.|..|.|.|.:::.|.
  Rat   387 RRSDLVTHQGTHTG-AKPHKCPICGKCFTQSSALVTHQRTH--TGVKPYPCPECGKCFSQRSNLI 448

  Fly   231 LHMKRHSNRERQSCSLCGKSYNDPDALGRHLRQHKTAERYRCIQCDITINRKDNMLRHLRSMHPG 295
            .|.:.|:..:...|..||||::....|..|.|.|:....|.|..|..:.:|:.|:.||.:....|
  Rat   449 AHNRTHTGEKPYHCLDCGKSFSHSSHLTAHQRTHRGVRPYSCPLCGKSFSRRSNLHRHEKIHTTG 513

  Fly   296 CAFASTVEMVTPRSSAQEATTA 317
               ...:.|:...::|..|.||
  Rat   514 ---PKALAMLMLGAAAAGALTA 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 6/29 (21%)
C2H2 Zn finger 103..123 CDD:275368 10/19 (53%)
COG5048 <112..288 CDD:227381 55/177 (31%)
C2H2 Zn finger 131..151 CDD:275368 7/19 (37%)
Chordopox_A33R 151..>254 CDD:283591 33/104 (32%)
C2H2 Zn finger 158..178 CDD:275368 8/19 (42%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 8/19 (42%)
C2H2 Zn finger 272..290 CDD:275368 6/17 (35%)
Zfp13NP_001382483.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.