DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and ZNF575

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001381166.1 Gene:ZNF575 / 284346 HGNCID:27606 Length:245 Species:Homo sapiens


Alignment Length:176 Identity:54/176 - (30%)
Similarity:74/176 - (42%) Gaps:11/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 CKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPICQKVFR 166
            |.:|.:.|:..|.|..|.::|.....|.|..|.|:|..|..|..|.|||:..: |.||.|.|.|.
Human    65 CPDCDKAFSYPSKLATHRLAHGGARPHPCPDCPKAFSYPSKLAAHRLTHSGARPHPCPHCPKSFG 129

  Fly   167 RKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIR-HMCKVCQKSFLRQTTLR 230
            .:|.||:||..|:.. ..:.|..|.|.|...:.|..|...|...:.| :.|..|.|:|...:.|.
Human   130 HRSKLAAHLWTHAPT-RPYPCPDCPKSFCYPSKLAAHRHTHHATDARPYPCPHCPKAFSFPSKLA 193

  Fly   231 LHMKRHSNRER--------QSCSLCGKSYNDPDALGRHLRQHKTAE 268
            .|...|.....        ..||.||:::.....|..|.|.|...|
Human   194 AHRLCHDPPTAPGSQATAWHRCSSCGQAFGQRRLLLLHQRSHHQVE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 6/19 (32%)
COG5048 <112..288 CDD:227381 51/167 (31%)
C2H2 Zn finger 131..151 CDD:275368 8/19 (42%)
Chordopox_A33R 151..>254 CDD:283591 32/112 (29%)
C2H2 Zn finger 158..178 CDD:275368 10/19 (53%)
C2H2 Zn finger 187..207 CDD:275368 6/19 (32%)
C2H2 Zn finger 216..236 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
C2H2 Zn finger 272..290 CDD:275368
ZNF575NP_001381166.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67 1/1 (100%)
PHA03247 <6..211 CDD:223021 45/146 (31%)
C2H2 Zn finger 67..85 CDD:275368 5/17 (29%)
C2H2 Zn finger 93..113 CDD:275368 8/19 (42%)
C2H2 Zn finger 121..141 CDD:275368 10/19 (53%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
C2H2 Zn finger 179..199 CDD:275368 6/19 (32%)
C2H2 Zn finger 215..235 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.