DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42726 and ZSCAN1

DIOPT Version :9

Sequence 1:	NP_732017.3	Gene:	CG42726 / 318709	FlyBaseID:	FBgn0261679	Length:	441	Species:	Drosophila melanogaster
Sequence 2:	XP_006723212.1	Gene:	ZSCAN1 / 284312	HGNCID:	23712	Length:	448	Species:	Homo sapiens

Alignment Length:	128	Identity:	34/128 - (26%)
Similarity:	47/128 - (36%)	Gaps:	20/128 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly    99 KKFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEKHLCPICQK 163
            :.|.|.:||..|...:|...|..:|.::....|..|.|.|....||..|...|..|    |..:|
Human   330 RPFQCADCGMVFTWVTHFIEHQKTHREEGPFPCPECGKVFLHNSVLTEHGKIHLLE----PPRKK 390

  Fly   164 VFRRKSSLASHLAIHSDLGLQ-----------FKCELCSKHFQNKANLNQHLRKHDKNNIRHM 215
            ..|.|....|   :....|.|           |:|.:|.|.|....:|..|.:.|..:.  ||
Human   391 APRSKGPRES---VPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQKLHTAHG--HM 448

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42726	NP_732017.3	C2H2 Zn finger	74..94	CDD:275368
		C2H2 Zn finger	103..123	CDD:275368	6/19 (32%)
		COG5048	<112..288	CDD:227381	29/115 (25%)
		C2H2 Zn finger	131..151	CDD:275368	7/19 (37%)
		Chordopox_A33R	151..>254	CDD:283591	19/76 (25%)
		C2H2 Zn finger	158..178	CDD:275368	5/19 (26%)
		C2H2 Zn finger	187..207	CDD:275368	6/19 (32%)
		C2H2 Zn finger	216..236	CDD:275368	34/128 (27%)
		C2H2 Zn finger	244..264	CDD:275368
		C2H2 Zn finger	272..290	CDD:275368
ZSCAN1	XP_006723212.1	SCAN	75..162	CDD:280241
		C2H2 Zn finger	334..354	CDD:275368	6/19 (32%)
		zf-H2C2_2	346..371	CDD:290200	7/24 (29%)
		C2H2 Zn finger	362..382	CDD:275368	7/19 (37%)
		C2H2 Zn finger	422..442	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23226
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100