DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and ZNF396

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001309215.1 Gene:ZNF396 / 252884 HGNCID:18824 Length:335 Species:Homo sapiens


Alignment Length:177 Identity:42/177 - (23%)
Similarity:70/177 - (39%) Gaps:45/177 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QETQETQARTSADKRIIVTDKG--YHCTVCN---------KDFRSRTQQ--YYHLTCGNDLLKK- 100
            ::.:.|..::::.::   |..|  .||.|.|         ..:|...:|  .:....||...|| 
Human   189 EDIKTTNVKSASRQK---TSLGIELHCNVSNILHMNGSQSSTYRGTYEQDGRFEKRQGNPSWKKQ 250

  Fly   101 FNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEKHLCPICQKVF 165
            ..|.|||:.|:.||.|..|...|..:..::|..|.|:|.:..:|.:|..||..||          
Human   251 QKCDECGKIFSQSSALILHQRIHSGKKPYACDECAKAFSRSAILIQHRRTHTGEK---------- 305

  Fly   166 RRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNI 212
                              .:||..|.|.|...:||.:|.::|.:..:
Human   306 ------------------PYKCHDCGKAFSQSSNLFRHRKRHIRKKV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 5/30 (17%)
C2H2 Zn finger 103..123 CDD:275368 9/19 (47%)
COG5048 <112..288 CDD:227381 24/101 (24%)
C2H2 Zn finger 131..151 CDD:275368 6/19 (32%)
Chordopox_A33R 151..>254 CDD:283591 12/62 (19%)
C2H2 Zn finger 158..178 CDD:275368 0/19 (0%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..290 CDD:275368
ZNF396NP_001309215.1 SCAN 48..157 CDD:128708
SCAN 48..136 CDD:280241
COG5048 239..>306 CDD:227381 24/94 (26%)
zf-C2H2 252..273 CDD:278523 9/20 (45%)
C2H2 Zn finger 253..273 CDD:275368 9/19 (47%)
zf-H2C2_2 269..290 CDD:290200 6/20 (30%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 294..318 CDD:290200 11/51 (22%)
C2H2 Zn finger 309..329 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.