Sequence 1: | NP_732017.3 | Gene: | CG42726 / 318709 | FlyBaseID: | FBgn0261679 | Length: | 441 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011248809.1 | Gene: | Zscan18 / 232875 | MGIID: | 3643810 | Length: | 864 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 44/201 - (21%) |
---|---|---|---|
Similarity: | 79/201 - (39%) | Gaps: | 59/201 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 261 LRQHKTAERYRCIQCDITINRKDNMLRHLRSMHPGCAFASTVEMVTPRSSAQEATTAEERPSQTV 325
Fly 326 RYNSVIQSVGNVEP----------VMLLQSTPL----PSQLPE-LQMEKGKAVPEHLPLPDVMPE 375
Fly 376 ENVQLYRKIILD--LDNEEYSSEPSPDAQEPAMQH---HQPRVPGQGSSKFSEMHWRKNF---KY 432
Fly 433 WYQKEE 438 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42726 | NP_732017.3 | C2H2 Zn finger | 74..94 | CDD:275368 | |
C2H2 Zn finger | 103..123 | CDD:275368 | |||
COG5048 | <112..288 | CDD:227381 | 4/26 (15%) | ||
C2H2 Zn finger | 131..151 | CDD:275368 | |||
Chordopox_A33R | 151..>254 | CDD:283591 | |||
C2H2 Zn finger | 158..178 | CDD:275368 | |||
C2H2 Zn finger | 187..207 | CDD:275368 | |||
C2H2 Zn finger | 216..236 | CDD:275368 | |||
C2H2 Zn finger | 244..264 | CDD:275368 | 0/2 (0%) | ||
C2H2 Zn finger | 272..290 | CDD:275368 | 4/17 (24%) | ||
Zscan18 | XP_011248809.1 | PAT1 | <55..>208 | CDD:370676 | 25/135 (19%) |
SCAN | 453..540 | CDD:366881 | |||
C2H2 Zn finger | 833..853 | CDD:275370 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23226 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |