DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and Zscan18

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_011248809.1 Gene:Zscan18 / 232875 MGIID:3643810 Length:864 Species:Mus musculus


Alignment Length:201 Identity:44/201 - (21%)
Similarity:79/201 - (39%) Gaps:59/201 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 LRQHKTAERYRCIQCDITINRKDNMLRHLRSMHPGCAFASTVEMVTPRSSAQEATTAEERPSQTV 325
            ::|.:.:::..|       .|:|.::|.          ...::::  .:|.:|..:.::.|||..
Mouse   102 IKQQEPSQQEEC-------RRQDELIRK----------EEPIQLL--ETSQREELSEQQEPSQQD 147

  Fly   326 RYNSVIQSVGNVEP----------VMLLQSTPL----PSQLPE-LQMEKGKAVPEHLPLPDVMPE 375
            ..:...:||...||          |.:.|..|:    |||..| :|.::           .:..|
Mouse   148 EPSQEEESVQLQEPSQWGEPGQKDVPMQQEEPMQQDEPSQWEEPMQQDE-----------PMQQE 201

  Fly   376 ENVQLYRKIILD--LDNEEYSSEPSPDAQEPAMQH---HQPRVPGQGSSKFSEMHWRKNF---KY 432
            |.:|....|..|  :..||.:.:..|..|:.::|.   ||.| |.|     .|:..|:.|   ..
Mouse   202 ELMQQTEPIEQDKPIQQEELTQQEEPIQQDASIQRELIHQVR-PIQ-----KELILREEFIQQDK 260

  Fly   433 WYQKEE 438
            ..||||
Mouse   261 CTQKEE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368
COG5048 <112..288 CDD:227381 4/26 (15%)
C2H2 Zn finger 131..151 CDD:275368
Chordopox_A33R 151..>254 CDD:283591
C2H2 Zn finger 158..178 CDD:275368
C2H2 Zn finger 187..207 CDD:275368
C2H2 Zn finger 216..236 CDD:275368
C2H2 Zn finger 244..264 CDD:275368 0/2 (0%)
C2H2 Zn finger 272..290 CDD:275368 4/17 (24%)
Zscan18XP_011248809.1 PAT1 <55..>208 CDD:370676 25/135 (19%)
SCAN 453..540 CDD:366881
C2H2 Zn finger 833..853 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.