DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42726 and ZSCAN23

DIOPT Version :9

Sequence 1:	NP_732017.3	Gene:	CG42726 / 318709	FlyBaseID:	FBgn0261679	Length:	441	Species:	Drosophila melanogaster
Sequence 2:	NP_001012458.1	Gene:	ZSCAN23 / 222696	HGNCID:	21193	Length:	389	Species:	Homo sapiens

Alignment Length:	193	Identity:	55/193 - (28%)
Similarity:	81/193 - (41%)	Gaps:	39/193 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   103 CKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPICQKVFR 166
            |...||       |:...:|...:..:.||.|.|||.|..:|..|..||..|| :.|..|.:.|.
Human   230 CDREGR-------LEKQRVSSSVERPYICSECGKSFTQNSILIEHQRTHTGEKPYECDECGRAFS 287

  Fly   167 RKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQTTLRL 231
            ::|.|..|..:|:. ..:::|.:|.|.|...|.|..|||.|.... .:.|..|.|||.|::.|..
Human   288 QRSGLFQHQRLHTG-EKRYQCSVCGKAFSQNAGLFHHLRIHTGEK-PYQCNQCNKSFSRRSVLIK 350

  Fly   232 HMKRHSNRERQSCSLCGKSYNDPDALGRHLRQHKTAERYRCIQCDITINRKDNMLRHLRSMHP 294
            |.:.|:......|..|||::                 .|.|           |:::| |.:||
Human   351 HQRIHTGERPYECEECGKNF-----------------IYHC-----------NLIQH-RKVHP 384

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42726	NP_732017.3	C2H2 Zn finger	74..94	CDD:275368
		C2H2 Zn finger	103..123	CDD:275368	4/19 (21%)
		COG5048	<112..288	CDD:227381	48/176 (27%)
		C2H2 Zn finger	131..151	CDD:275368	9/19 (47%)
		Chordopox_A33R	151..>254	CDD:283591	33/103 (32%)
		C2H2 Zn finger	158..178	CDD:275368	6/19 (32%)
		C2H2 Zn finger	187..207	CDD:275368	9/19 (47%)
		C2H2 Zn finger	216..236	CDD:275368	8/19 (42%)
		C2H2 Zn finger	244..264	CDD:275368	4/19 (21%)
		C2H2 Zn finger	272..290	CDD:275368	3/17 (18%)
ZSCAN23	NP_001012458.1	SCAN	44..156	CDD:128708
		SCAN	45..132	CDD:280241
		COG5048	<215..384	CDD:227381	53/191 (28%)
		zf-C2H2	249..271	CDD:278523	9/21 (43%)
		C2H2 Zn finger	251..271	CDD:275368	9/19 (47%)
		zf-H2C2_2	264..288	CDD:290200	9/23 (39%)
		C2H2 Zn finger	279..299	CDD:275368	6/19 (32%)
		zf-H2C2_2	292..316	CDD:290200	7/24 (29%)
		C2H2 Zn finger	307..327	CDD:275368	9/19 (47%)
		zf-H2C2_2	323..344	CDD:290200	9/21 (43%)
		C2H2 Zn finger	335..355	CDD:275368	8/19 (42%)
		zf-H2C2_2	348..372	CDD:290200	7/40 (18%)
		C2H2 Zn finger	363..383	CDD:275368	9/48 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23226
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	2.010