Sequence 1: | NP_732017.3 | Gene: | CG42726 / 318709 | FlyBaseID: | FBgn0261679 | Length: | 441 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001354686.1 | Gene: | ZNF275 / 10838 | HGNCID: | 13069 | Length: | 429 | Species: | Homo sapiens |
Alignment Length: | 331 | Identity: | 88/331 - (26%) |
---|---|---|---|
Similarity: | 126/331 - (38%) | Gaps: | 66/331 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 CLECRVARSVDIQETQETQARTSADKRIIVTDKGYHCTVCNKDFRSRTQQYYH------------ 90
Fly 91 --LTCGNDLLKK---------FNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVL 144
Fly 145 QRHMLTHNQEK--------------------------HL---CPICQKVFRRKSSLASHLAIHSD 180
Fly 181 LGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQTTLRLHMKRHSNRERQSCS 245
Fly 246 LCGKSYNDPDALGRHLRQHKTAERYRCIQCDITINRKDNMLRHLRSMHPG---CAFASTVEMVTP 307
Fly 308 RSSAQE 313 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42726 | NP_732017.3 | C2H2 Zn finger | 74..94 | CDD:275368 | 6/33 (18%) |
C2H2 Zn finger | 103..123 | CDD:275368 | 9/19 (47%) | ||
COG5048 | <112..288 | CDD:227381 | 57/204 (28%) | ||
C2H2 Zn finger | 131..151 | CDD:275368 | 8/19 (42%) | ||
Chordopox_A33R | 151..>254 | CDD:283591 | 36/131 (27%) | ||
C2H2 Zn finger | 158..178 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 187..207 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 216..236 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 244..264 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 272..290 | CDD:275368 | 5/17 (29%) | ||
ZNF275 | NP_001354686.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 31..95 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 149..176 | 2/26 (8%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23226 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |