DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42726 and Zfp174

DIOPT Version :9

Sequence 1:	NP_732017.3	Gene:	CG42726 / 318709	FlyBaseID:	FBgn0261679	Length:	441	Species:	Drosophila melanogaster
Sequence 2:	XP_006245901.1	Gene:	Zfp174 / 102551846	RGDID:	7498198	Length:	406	Species:	Rattus norvegicus

Alignment Length:	102	Identity:	35/102 - (34%)
Similarity:	49/102 - (48%)	Gaps:	6/102 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   166 RRKSSL---ASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQT 227
            |..|||   ..|.|.||  ...::|:.|.|.|...:.|.:|.|.|.... .::|..|...|.||:
  Rat   305 RSLSSLLQRLGHQAAHS--AKPYRCDDCGKSFTWNSELKRHTRVHTGER-PYICGECGNCFGRQS 366

  Fly   228 TLRLHMKRHSNRERQSCSLCGKSYNDPDALGRHLRQH 264
            ||:||.:.|:..:...||.|||.:.....|.:|.|.|
  Rat   367 TLKLHQRIHTGEKPYQCSHCGKCFRQSSNLHQHHRLH 403

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42726	NP_732017.3	C2H2 Zn finger	74..94	CDD:275368
		C2H2 Zn finger	103..123	CDD:275368
		COG5048	<112..288	CDD:227381	35/102 (34%)
		C2H2 Zn finger	131..151	CDD:275368
		Chordopox_A33R	151..>254	CDD:283591	31/90 (34%)
		C2H2 Zn finger	158..178	CDD:275368	6/14 (43%)
		C2H2 Zn finger	187..207	CDD:275368	7/19 (37%)
		C2H2 Zn finger	216..236	CDD:275368	9/19 (47%)
		C2H2 Zn finger	244..264	CDD:275368	8/19 (42%)
		C2H2 Zn finger	272..290	CDD:275368
Zfp174	XP_006245901.1	SCAN	42..152	CDD:128708
		SCAN	42..130	CDD:280241
		zf-C2H2	325..347	CDD:278523	7/21 (33%)
		C2H2 Zn finger	327..347	CDD:275368	7/19 (37%)
		zf-H2C2_2	339..364	CDD:290200	7/25 (28%)
		COG5048	351..>406	CDD:227381	19/54 (35%)
		C2H2 Zn finger	355..375	CDD:275368	9/19 (47%)
		zf-H2C2_2	368..392	CDD:290200	9/23 (39%)
		C2H2 Zn finger	383..403	CDD:275368	8/19 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23226
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100