DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31380 and pkdc

DIOPT Version :9

Sequence 1:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:319 Identity:70/319 - (21%)
Similarity:107/319 - (33%) Gaps:92/319 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 MKKAPYDIYNRELEIYE-QVLPKLQEL---AGEQLCPKILHIDR-QRGALIMEDLSYKGFVMAPR 133
            |||...|:..:|..... |:..|:|.|   .||.:   .:|::. .|.:::::      .||.|:
Zfish     1 MKKEHQDLVLKECGAKSLQIGAKIQTLWSGYGEII---RVHLEGCDRPSVVVK------HVMFPQ 56

  Fly   134 LQR------LDEQHVSLVLRKLAKMQAASAVLENNLLENN-----------------FSLTEYD- 174
            .|:      .|..|    .||:...|..:...:|.....|                 ..|.:.| 
Zfish    57 NQKHPGGWNTDISH----QRKVRSYQVETYWYQNYTTNENCRVPLCLAAKSFGEEQLIVLEDLDV 117

  Fly   175 KGFFNRYTESFSAYFLGCLKSCANYLKTQAGYEHHAKLLDELAP-------YYMGLGLRCFKQE- 231
            .||..|.|....|....||...||:         ||..|| :.|       .|..|..|..:.| 
Zfish   118 AGFPVRKTYVNDAEIKACLSWIANF---------HALFLD-VTPEGLWPIGTYWHLETRPEELEA 172

  Fly   232 ------------------QTHINVLTHGDLWTNNMMFKYEAGVPSDVLLIDFQYAFWGSPTLDIH 278
                              ......:.|||....|..|..:.   ..|..:||||...|....|:.
Zfish   173 MSDQKLKAAAGEIDSILNNCRFKTIVHGDAKLANFCFSKDG---LQVASVDFQYVGGGCGMKDVI 234

  Fly   279 HLLNTSAVEQVRSELQMKMRGVYHDVFVGELQRLGFKGQRLPSRKQF-HLESEQKRFYA 336
            :.|.:...|:   |.:.|..|:. |.:..||::      .|..:..| .||.|.:..:|
Zfish   235 YFLGSCMDER---ECEKKAPGLL-DYYFSELRK------SLEKKVDFAELEKEWRNMFA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 64/294 (22%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 41/193 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.