DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31380 and CHKov2

DIOPT Version :9

Sequence 1:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster


Alignment Length:418 Identity:112/418 - (26%)
Similarity:196/418 - (46%) Gaps:46/418 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WLTAEYLEAALRRYYQNNELRVESMVINPALGKGENYGAILTRI----HLVYSSIVEEHLIAKTV 64
            |:|.|...:.|.:..:|.:..:: .|...|:.|||||..|:.||    .|..:||.:...|.|..
  Fly     9 WVTKELFSSLLEQSNRNFKAIIK-FVPTSAISKGENYLTIVLRIQIEMQLKDNSIEDVSYILKIP 72

  Fly    65 LEYEDAETKMKKAPYDIYNRELEIYEQVLPKLQELAGE--QLCPKI--LHI-----DRQRGALIM 120
            |..||.:...    :::::.||::|:.::|:|::|..:  .:.||.  :|:     ..:...:::
  Fly    73 LVPEDEKNDF----HEMFDAELDMYDHLIPELEDLYAKNTSISPKFKPVHLKFPGEPVKSDYILL 133

  Fly   121 EDLSYKGFVMAPRLQRLDEQHVSLVLRKLAKMQAASA-------VLENNLLENNFSLTEYDKGFF 178
            |||..||:..|.|.|.|::..|..||:|||:..||||       ..|.::.|:.|: ||:.| ..
  Fly   134 EDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESYFT-TEHQK-LL 196

  Fly   179 NRYTESFSAYFLGCLKSCANYLKTQAGYEHHAKLLDELAPYYMGLGLRCFKQEQTHINVLTHGDL 243
            :.:..:|...||.|::.    ...:.|   ...|:.:.......|.:...|.:...::||.|||.
  Fly   197 DEFNINFCMPFLECMQQ----YNLEPG---QLVLISDYTSQLTDLNIEFGKNDPLELSVLNHGDF 254

  Fly   244 WTNNMMFKYE-AGVPSDVLLIDFQYAFWGSPTLDIHHLLNTSAVEQVRSELQMKMRGVYHDVFVG 307
            |.||.||||: |....||..:|||...:|:|..|:..:|.||....::.:........||...|.
  Fly   255 WCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKLDKFDYFIEYYHQQLVE 319

  Fly   308 ELQRLGFKGQRLPSRKQFHLESEQKRFYAVHCGLLLLPVLLNTDETDADFAALLSDQPRGMDMKR 372
            .|..|.: .:..|:..:||....:...:|..|...:||::|...:.|:....::.:....:..||
  Fly   320 HLTMLNY-NRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHIGNVMGNSEEAIAFKR 383

  Fly   373 RLYLNPGIQDSIKQMVKHFELEGLLDPW 400
            :::|.|...|.||.::          ||
  Fly   384 KMFLLPAYVDQIKVIL----------PW 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 87/298 (29%)
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 87/298 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.