DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31380 and CG10562

DIOPT Version :10

Sequence 1:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster


Alignment Length:64 Identity:17/64 - (26%)
Similarity:32/64 - (50%) Gaps:11/64 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1358 TEGQEEFKKPVKIEKSPTSPQAKSNWTAVAK-KAAAKPFGVDMAQLKASENKPSDKP--LEPAK 1418
            |.||:        .|:.::|:..:|....:: :|:.||.....|::.|:.|:|:..|  ..|||
  Fly   149 TNGQQ--------RKTQSAPRPTANKQQQSRDQASNKPQTTGNAKVPATVNQPASNPTTANPAK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31380NP_733121.1 EcKL 36..314 CDD:397213
CG10562NP_651385.3 EcKL 41..325 CDD:397213 17/64 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.