DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31380 and CG6830

DIOPT Version :9

Sequence 1:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:446 Identity:111/446 - (24%)
Similarity:186/446 - (41%) Gaps:90/446 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WLT----AEYLEAALRRYYQNNELRVESMVINPALGKGENYGAILTRIHLVYSSIVEEHLIAKTV 64
            ||.    .|.|.|.:.::     .::....:.||:..||||..::.||.:              .
  Fly    49 WLNQTQFEELLAADVDQF-----SKIVGFRVKPAMAPGENYATLMLRISI--------------D 94

  Fly    65 LEYEDAETK----MKKAPYD------------IYNRELEIYEQVLPKLQEL-----AGEQLCPKI 108
            :|..|..||    |.|.|:|            .:..|...|.::|||::||     ...:..|:.
  Fly    95 VELTDKSTKLVSFMMKVPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRA 159

  Fly   109 LHIDRQR-----GALIMEDLSYKGFVMAPRLQRLDEQHVSLVLRKLAKMQAASA----------- 157
            ..:|..:     ..::|.||...||....||:.|:.:.....|.:||:..||.|           
  Fly   160 FKLDATKEPKVANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPD 224

  Fly   158 VLENNLLENNFSLTEYDKGFFNRYTESFSAYFLGCLKS-----CANYLKTQAGYEHHAKL---LD 214
            :..|.::.||              .|:..|:..|.|.|     .||..|.:.|.|:..||   |.
  Fly   225 IFVNGVMGNN--------------KEAIIAFMEGMLASFRTSFMANLDKFKNGEEYREKLEKALA 275

  Fly   215 ELAPYYMGLGLRCFKQEQTHINVLTHGDLWTNNMMFKY-EAGVPSDVLLIDFQYAFWGSPTLD-I 277
            .|...:|.||:    .:....|.|.|||.|.||::||. .:|...|::.:|||...:|||.:| :
  Fly   276 GLTMEFMKLGI----VDPNEFNALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLL 336

  Fly   278 HHLLNTSAVEQVRSELQMKMRGVYHDVFVGELQRLGFKGQRLPSRKQFHLESEQKRFYAVHCGLL 342
            :.::::..::...|.....:|. |.:..|..|..|||.| |.||.::.|....:...:.:...:.
  Fly   337 YFIISSVQIDYKLSHFDFFIRH-YQEALVKHLGILGFTG-RKPSLRELHRTLIKYGGWVLFPTIS 399

  Fly   343 LLPVLLNTDETDADFAALLSDQPRGMDMKRRLYLNPGIQDSIKQMVKHFELEGLLD 398
            :||::|......|.|...:||...|:..:..||.|...|:.|::::...:..|.|:
  Fly   400 VLPLVLLDPTQSATFDNFMSDSADGVSFRGSLYANKRCQEYIERILPWLDNRGFLE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 82/324 (25%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 82/324 (25%)
EcKinase 516..800 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459436
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.