DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31380 and CG33511

DIOPT Version :9

Sequence 1:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:393 Identity:92/393 - (23%)
Similarity:166/393 - (42%) Gaps:75/393 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GENYGAILTRIHL----------VYSSIVEEHLIAKTVLEYEDAETKMKKAPYDIYNRELEIYEQ 91
            ||.|     ::||          .:.:...:.|..|...:.|:.|.|      .::.:|..:|.|
  Fly    44 GEYY-----KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERK------GVFQKESALYSQ 97

  Fly    92 VLPKLQELAGEQLCPKILHIDRQRGALIMEDLS--YKGFVMAPRLQRLDEQHVSLVLRKLAKMQA 154
            :|||:|:.|.::|.||..:  .:...|::|||:  |: .:.|.....||  |..:||..|:::.|
  Fly    98 ILPKIQKYATKKLYPKCYY--SRNDILVLEDLTQDYR-HLRANEYYTLD--HYKIVLEHLSELHA 157

  Fly   155 ASAVLENNLLENNFSLTEYDKGFFNRYTESFSAYFLGCLKS---------------CANYLKTQA 204
            ||...|..  ||......|.......:.:|.:::::..||:               ..|:::.:.
  Fly   158 ASIAWEEK--ENVKIYESYKNVLIELHLDSNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKL 220

  Fly   205 GYEHHAKLLDELAPYYMGLGLRCFKQEQTHINVLTHGDLWTNNMMF---KYEAGVPSDVLLIDFQ 266
             |....|..:.:||            .:|..|||.|.|.|.:|:::   |..:.:|:...::|||
  Fly   221 -YNLLTKAEELVAP------------SKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQ 272

  Fly   267 YAFWGSPTLDIHHLLNTSAVEQVRSELQMKMRGVYHDVFVGELQRLGFKGQRLPSRKQFHLESEQ 331
            ...:.|||||:..||...|..:||..:..:....|:......|.|||. .:.|.:...|..|.::
  Fly   273 LTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGL-DKNLITENNFRKECQR 336

  Fly   332 KRFYAVHCGLLLLPVLLNTDETDADFAALLSDQPRGMD----------MKRRLYLNPGIQDSIKQ 386
            .|..|:....|..|   .|..:.:....|.|::|...|          :.|.:.:.||.:::|..
  Fly   337 TRLAALVIWALTEP---QTKMSPSISNRLRSEEPEKFDYYLNCDRSELLLRVIEIQPGYEETIMT 398

  Fly   387 MVK 389
            .::
  Fly   399 PIR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 75/306 (25%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 74/305 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.