DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31380 and CG5126

DIOPT Version :9

Sequence 1:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:429 Identity:80/429 - (18%)
Similarity:146/429 - (34%) Gaps:131/429 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 HLVY--------SSIVEEHLIA-------------KTVLEYEDAETKMKKA-------------- 77
            ||||        |:.:|.|.:.             ...|:...||.|..:.              
  Fly    14 HLVYDIFKNFGPSASLESHSVECSNGLDGFMSALYTVTLDVVIAERKRTEVVLVKFMKGTEEFRE 78

  Fly    78 ---PYDIYNRELEIYEQVLPKLQE-LAGEQLCPKIL-------------HID----RQRGALIME 121
               .|..::.|:..|.::||..:. |....|..:::             |::    .:...|.::
  Fly    79 SSNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLALK 143

  Fly   122 DLSYKGFVMAPRLQRLDEQHVSLV--LRKLAKMQAASAVLENN--------LLENNFSLTEYDKG 176
            .|...|:.:.|||....:|..::|  :.....:..|:.:|:.|        :::..| ::...||
  Fly   144 HLKGDGYQLGPRLTLRRDQLEAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMPF-VSSSGKG 207

  Fly   177 FFN-RYTESFSAYFLGCLKSCANYLKTQAGYEHH----AKLLDELAPYYMGLGL-------RCFK 229
            .|: .|..:|..:                 ||.:    .:||....|   |.|.       :.||
  Fly   208 IFDVLYRVAFDRF-----------------YEFYDRQKEQLLQGADP---GFGAAIERLREKYFK 252

  Fly   230 -----------------QEQTHINVLTHGDLWTNNMMFKYEAGVPSDVL-LIDFQYAFWGSPTLD 276
                             |..:|.....|||...||::|.|.|....|.: .||||...:.:..:|
  Fly   253 QPTLLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAID 317

  Fly   277 IHHLLNTSAVEQVRSELQMKMRGVYHDVFVGELQRLGFKGQRLP-------------SRKQFHLE 328
            :...:..:...:.|.|:...:...||...: |:..|..:..|..             |.::|:..
  Fly   318 LSFFMYMNTPSEGRKEIYADLLRKYHRSMI-EMLELVLRRNRNELTDDRVDQLLQEYSFERFNAH 381

  Fly   329 SEQKRFYAVHCGLLLLPVLLNTDETDADFAALLSDQPRG 367
            .::..||.....:..||.||.|::..|:.:.|......|
  Fly   382 FKRYAFYGPMVCMHFLPWLLGTEKDCAELSRLFETDMHG 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 67/361 (19%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 59/333 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.