DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31380 and CG31974

DIOPT Version :9

Sequence 1:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:385 Identity:87/385 - (22%)
Similarity:144/385 - (37%) Gaps:92/385 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GENYGAIL----TRIHLVYSSIVEEHLIAKTVLEYEDAETKMKKAPYDIYNR----------ELE 87
            |:|||:|:    .:|......|.:..|||           |:.....|:|.:          |..
  Fly    36 GDNYGSIMLSVQAKIRSADGGIRDLPLIA-----------KLPPLTNDLYWQIFQPERTCITENA 89

  Fly    88 IYEQVLPKLQELAGE--------------------QLCPKILHIDRQRGALIMEDLSYKGFVMAP 132
            :|:.:.|:|.:|..|                    .|..:...:||. ..|:.|:::.:|:....
  Fly    90 VYQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRD-AVLVQENVTTRGYRPGN 153

  Fly   133 RLQRLDEQHVSLVLRKLAKMQAASAVLENNLLENNFSLTEYDKGFFNRY----------TESFSA 187
            |.:..:.....|:|..||:..|....|.   |:......||.:.:|.::          ||..: 
  Fly   154 RHRPYNLAETVLILHYLAQYHALPIALR---LKKPQVYEEYVRPYFKKFDMNSNIDQAETEIMN- 214

  Fly   188 YFLGCLKSCANYLKTQAGYEHHAKLLDELAPYYMGLGLRCFKQEQTHINV-------LTHGDLWT 245
                  |.....:|.....|.....:.||        |..|:..|...:|       |.|||||.
  Fly   215 ------KEILKDIKLVTSDERDVNRVKEL--------LDIFQAFQASNDVDDGPFTTLVHGDLWI 265

  Fly   246 NNMMFKY----EAGVPSDVLLIDFQYAFWGSPTLDIHHLLNTSAVEQVRSELQMKMRGVYHDVFV 306
            ||||.||    |.|.|..|.::|||.|.:||...||..:|.:|....|..:.......:|::.|:
  Fly   266 NNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFI 330

  Fly   307 GELQRLGFKGQRLPSRKQFHLESEQKRFYAVHCGLLLLPVLLNTDET------DADFAAL 360
            ..|:.:....... :.:.|..|.:|.....:...:.::.|:|..:.|      |.||:.|
  Fly   331 QTLRSVNVDTSNY-TYELFLEEVQQTAHVQLPHAIFMMKVILADNSTIPKDYKDVDFSVL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 77/331 (23%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 77/330 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459336
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.