DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31380 and CG7135

DIOPT Version :9

Sequence 1:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:379 Identity:102/379 - (26%)
Similarity:165/379 - (43%) Gaps:44/379 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WLTAEYLEAALRRYYQNNELRVESMVINPALGKGENYGAILTRIHLVY----SSIVEEHLIAKTV 64
            :||.::....|....|..:|:|..:.:......||||.:.:.|..:.|    |..:|..||.|::
  Fly    11 YLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCAMETSLIVKSM 75

  Fly    65 LEYEDAETKMKKAPYDIYNRELEIYEQVLPKLQEL--------AGEQLCPKILHIDRQ-RGALIM 120
            .:    |.:...|...|||:|...|..:.|||:.|        :...|.||..:...| ...:|:
  Fly    76 PD----EKQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQPEQTIIL 136

  Fly   121 EDLSYKGFVMAPRLQRLDEQHVSLVLRKLAKMQAASAVLENNLLENNFSLTEYDKGFFNR---YT 182
            |||...|:.:..|...||..|.:||:.|||:..|.:.|:...  |....:..|..|..:.   .:
  Fly   137 EDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAER--EPETIVDRYPFGLLHMDAINS 199

  Fly   183 ESFSAYF-------LGCLKSCANY--LKTQAGYEHHAKLLDELAPYYMGLGLRCFKQEQTHINVL 238
            |.|...|       ...:..|..:  :.|:. |.:|....:.:        |:.....:.:.|||
  Fly   200 EPFKLLFGTQLLKLAALVGDCEGFGGITTKL-YRYHEHFTERV--------LKAVYPLRGNHNVL 255

  Fly   239 THGDLWTNNMMFKYEAG-VPSDVLLIDFQYAFWGSPTLDIHHLLNTSAVEQVRSELQMKMRGVYH 302
            .|||||.||:.|||:|. ....|.:||||..|:||...||::.||||...:|..:.:.::..:|:
  Fly   256 NHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYY 320

  Fly   303 DVFVGELQRLGFKGQRLPSRKQFHLESEQKRFYA--VHCGLLLLPVLLNTDETD 354
            ...|..|:.|.: .:.|||.:....|..::..|.  |..|...|..::..|..|
  Fly   321 RSLVDCLKHLPW-SKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSED 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 86/303 (28%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 85/301 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459188
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
98.860

Return to query results.
Submit another query.