DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31380 and nhr-246

DIOPT Version :9

Sequence 1:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001256661.1 Gene:nhr-246 / 191499 WormBaseID:WBGene00014192 Length:386 Species:Caenorhabditis elegans


Alignment Length:336 Identity:73/336 - (21%)
Similarity:128/336 - (38%) Gaps:101/336 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LRRYYQNNELRVESMVINPALGKG----ENYG--------AILTRI--------HLVYSSIVEEH 58
            :|.::.|::|....::..|...||    ||.|        :::.|.        :.::||:.|:.
 Worm    50 VRLHFDNDDLPKHVVLKIPQNTKGCSVVENAGGGVKNVDHSVVERFMHNTECNYYKLFSSLSEKP 114

  Fly    59 L-IAKTVLEYEDAETKMKKAPYDIYNRELEIYE-----QVLP-----KLQELAGEQLCPKILHID 112
            | |..|.|..:..|    |||..:.  .||:.|     .::|     :|.::..|.:...|..:.
 Worm   115 LQIPTTYLASKAGE----KAPVPVI--VLEMLEDCKLHDLIPGFNEDQLFKIVDELVKLHIFSLT 173

  Fly   113 RQRGALIMED---LSYKGFVMAPRLQRLDEQHVSLVLRKLAKMQAASAVLENNLLENNFSLTEYD 174
            .::...|:.|   |:..||:..         .|:.|.||||:......:|               
 Worm   174 TEKWKEIVPDESKLAMSGFLQC---------MVADVGRKLAQNPELGVIL--------------- 214

  Fly   175 KGFFNRYTESFSAYFLGCLKSCANYLKTQAGYEHHAKLLDELAPYYMGLGLRCFKQEQTHINVLT 239
                        :|....|.:..|||:         |:.||    |:         .:...:|:.
 Worm   215 ------------SYVENTLDTDPNYLQ---------KMRDE----YI---------NEERPSVIC 245

  Fly   240 HGDLWTNNMMFKYEAGVPSDVLLIDFQYAFWGSPTLDIHHLLNTSAVEQVRSELQMKMRGVYHDV 304
            |||||...:::..|..:..   ::|:|....|||..|:||:|:|....|.|......:...|::.
 Worm   246 HGDLWAPQILWDKEDNIAG---IVDWQATHRGSPMEDLHHILSTCTSVQNRKTFTKPLLDHYYNK 307

  Fly   305 FVGELQRLGFK 315
            ....|:..|||
 Worm   308 LKVGLKEKGFK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 66/311 (21%)
nhr-246NP_001256661.1 CHK 134..314 CDD:214734 49/242 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.