DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31380 and dhs-27

DIOPT Version :9

Sequence 1:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_508591.3 Gene:dhs-27 / 180632 WormBaseID:WBGene00000990 Length:320 Species:Caenorhabditis elegans


Alignment Length:209 Identity:33/209 - (15%)
Similarity:68/209 - (32%) Gaps:57/209 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VESMVINPALGKGENYGAILTRIHLVYSSIVEEHLIAKTVLEYEDAETKMKKAPYDIYNRELEIY 89
            :|.:.....|.|....|..:.:::.....:||:|........::..:..:...|.|:...::.|.
 Worm    65 IEELCKTRGLKKFYLIGRNIDKLNNTKKELVEQHGCEVMCHVHDFEKDDLSALPKDLETLDVGIL 129

  Fly    90 -------EQVLPKLQELAGEQLCPKILHIDRQRGALIMEDLSYKGFVMAPRLQRLDEQHVSLVLR 147
                   ..::..|.||. |.|..|||.::......:.|                      ::|.
 Worm   130 INCAGIAPHIIGTLTELP-EGLASKILRVNLMSAVKMTE----------------------MILP 171

  Fly   148 KLAKMQAASAVLENNLLENNFSLTEYDKGFFNRYTESFSAYFLGCLKSCANYLKTQAGYEHHAKL 212
            .:.|.       :..::.|..|:|.:..                 |...::|..::|.....:  
 Worm   172 NMVKK-------KRGIIVNISSMTGWRP-----------------LPYLSSYPASKAALSFFS-- 210

  Fly   213 LDELAPYYMGLGLR 226
             |.|:..|.|.|:|
 Worm   211 -DSLSDEYRGTGIR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 31/198 (16%)
dhs-27NP_508591.3 17beta-HSD1_like_SDR_c 48..294 CDD:187614 33/209 (16%)
adh_short 50..234 CDD:278532 33/209 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.