DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31380 and F58B4.5

DIOPT Version :9

Sequence 1:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_505788.1 Gene:F58B4.5 / 179513 WormBaseID:WBGene00010238 Length:423 Species:Caenorhabditis elegans


Alignment Length:354 Identity:72/354 - (20%)
Similarity:141/354 - (39%) Gaps:58/354 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 YEDAETK-MKKAPYDIYNRELEIYEQVLPKLQELAGEQLCPKILHIDRQRGALIMEDLSYKGFVM 130
            ::||:.| |.:....::|||:..|:.::        .:..|||............::...|.:::
 Worm    99 WDDAKLKGMGEVTRLLHNREVATYKILM--------REKHPKIPFTKVYASKPFDDENKLKAYLI 155

  Fly   131 A---PRLQRLDEQHVSLVLRKLAKMQAASAVLENNLLENNFSLTEYDKG------FFNRYTESFS 186
            :   |.:..:. .|.|:....|..:..|.|......::.:...|:|.:|      .|.::.:..|
 Worm   156 SEYYPNIHHIG-MHESIPAEDLIPVIHAIAAFSAIGMKLSEEETKYARGADFLDIVFGQFMDEKS 219

  Fly   187 AYFLGCLKSCANYLKTQAGYEHHAKLLDELA----PYYMGLGLRCFK---QEQTHINVLTHGDLW 244
            ...:..|      ||.....|:..|:.:.|.    .|:....::.||   |...:..||||.|||
 Worm   220 IERMNVL------LKASFPEEYLEKVEEMLKIYKDYYFQPQMIKNFKNTCQFFGYKPVLTHSDLW 278

  Fly   245 TNNMMFKYEAGVPSDVLLIDFQYAFWGSPTLDIHHLLNTSAVEQVRSELQMKMRGVYHDVFVGEL 309
            ::|.:...:....:...:||||.....:|..|:..|..:....:.|.|....:...|::.||.||
 Worm   279 SSNFLCTRDGEKVTLKAIIDFQTVSITTPAQDVGRLFASCLSTKDRREKADFLLEEYYNTFVNEL 343

  Fly   310 QRLGFKGQRLPSRKQFHLESEQKRFYAVHCGLL-------LLPVLLNTDETDADFAALLSDQPRG 367
            .     |..:|...|     :.|..|.|:..|:       :.|:|.:::.|:.     ..|..:.
 Worm   344 D-----GMDVPYTFQ-----QLKDSYQVYFPLMTTMVLPGIAPMLQHSNVTEE-----YKDSMKQ 393

  Fly   368 MDMKRRLYLNPGI----QDSIKQMVKHFE 392
            :.:.:.:.|...:    :.:||...|:||
 Worm   394 VALDKMIGLLEDVITTHESNIKNFPKYFE 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 55/263 (21%)
F58B4.5NP_505788.1 DUF1679 3..414 CDD:369592 67/344 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.