DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31380 and F59B1.8

DIOPT Version :9

Sequence 1:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:335 Identity:74/335 - (22%)
Similarity:125/335 - (37%) Gaps:99/335 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTAEYLEAALRRYYQ-NNELRVESMVINPALGKGENYGA--ILTRIHLVYSSIVEEHLIAKTVLE 66
            :|.|.:..|::.... .:||..||.:  ..:|:|..:.:  ||...|.   :|...||..|.:|:
 Worm    20 VTLEDVNKAIKEQMSTESELTAESKM--EVIGEGNGFSSCVILITCHW---TIPSSHLPKKLILK 79

  Fly    67 Y--------------EDAETKM------------KKAPYDIYNRELEIYEQVLPKLQELAGEQLC 105
            .              |:..:.|            :|:....:|.|:|..| ....|:.|    |.
 Worm    80 IVSFVHVQGLLNKSNEEGNSVMSPEEEAHVHAHFEKSCQKGHNLEVEFCE-AFGHLEGL----LL 139

  Fly   106 PKILHIDRQRGALIMEDLSYKGFVMAPRLQRLDEQH---------VSLVLRKLAKMQAASAVLEN 161
            ||:....:     ..||...||||....::....:|         :..:|:.||::||.|...| 
 Worm   140 PKVFFSQK-----FEEDNPNKGFVGMEFVEGSVVRHCYENVTVDELQPILKALARLQALSLSTE- 198

  Fly   162 NLLENNFSLTEYDKGFFNRYTESFSAYFLGCLKSCANYLKTQAGYEHHAKLLDELAPYYMGLGLR 226
                   |....|.|      |:|....:..|..  :.||   |....::.:|:      .|..:
 Worm   199 -------SCRNLDNG------EAFEESLMDMLSE--DGLK---GIFDQSRNIDQ------KLSEK 239

  Fly   227 CFKQEQTHINVLT-------------------HGDLWTNNMMF-KYEAGVPSDVLLIDFQYAFWG 271
            ..:.||.|..:|.                   |||||..|::: :.:.|..:|.:| |:|.:..|
 Worm   240 VERIEQNHKEILNLETVLNLNKVVGIDQKVICHGDLWAANILWTQTDGGFIADKVL-DYQESHMG 303

  Fly   272 SPTLDIHHLL 281
            :|..|:..||
 Worm   304 NPAEDLVRLL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 66/303 (22%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 74/335 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.