DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31373 and PDF1A

DIOPT Version :9

Sequence 1:NP_731495.1 Gene:CG31373 / 318700 FlyBaseID:FBgn0051373 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_563974.1 Gene:PDF1A / 838109 AraportID:AT1G15390 Length:269 Species:Arabidopsis thaliana


Alignment Length:178 Identity:80/178 - (44%)
Similarity:109/178 - (61%) Gaps:4/178 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GDPVLRQRAEEVPPEDIDSREINQIIDGMVKVLRHYDCVGVAAPQVGIPLRIIVME-FREGKQEQ 76
            |||||.::|.||.|.:|.|..|.:|||.|:||:|....||:||||:|:||||||:| .:|.....
plant    87 GDPVLHEKAREVDPGEIGSERIQKIIDDMIKVMRLAPGVGLAAPQIGVPLRIIVLEDTKEYISYA 151

  Fly    77 FKPEIY-EERKMSILPLAVFINPELEIISSQVNKHPEGCMSVRGYSAEVERYDKVRIRGIGKLGT 140
            .|.||. :||:.  ..|.|.:||.|:..|::.....|||:||.|:.|.||||.:|.:.|..:.|.
plant   152 PKEEILAQERRH--FDLMVMVNPVLKERSNKKALFFEGCLSVDGFRAAVERYLEVVVTGYDRQGK 214

  Fly   141 PSEMELEGWNARIAQHEVDHLNGTIYMDRMDLSTFNCILWEQINAAEG 188
            ..|:...||.|||.|||.|||:|.:|:|:|...||..:....:..|||
plant   215 RIEVNASGWQARILQHECDHLDGNLYVDKMVPRTFRTVDNLDLPLAEG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31373NP_731495.1 Pep_deformylase 7..171 CDD:279645 74/159 (47%)
PDF1ANP_563974.1 Pep_deformylase 83..240 CDD:238271 72/154 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 131 1.000 Domainoid score I1684
eggNOG 1 0.900 - - E1_COG0242
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I1846
OMA 1 1.010 - - QHG59626
OrthoDB 1 1.010 - - D1532656at2759
OrthoFinder 1 1.000 - - FOG0005148
OrthoInspector 1 1.000 - - otm3583
orthoMCL 1 0.900 - - OOG6_101584
Panther 1 1.100 - - O PTHR10458
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.