DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31373 and Pdf

DIOPT Version :9

Sequence 1:NP_731495.1 Gene:CG31373 / 318700 FlyBaseID:FBgn0051373 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_001073696.3 Gene:Pdf / 690214 RGDID:1582894 Length:254 Species:Rattus norvegicus


Alignment Length:181 Identity:75/181 - (41%)
Similarity:115/181 - (63%) Gaps:0/181 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PPYRHFTQIGDPVLRQRAEEVPPEDIDSREINQIIDGMVKVLRHYDCVGVAAPQVGIPLRIIVME 68
            |||....|:||||||..|..|.|:.:...|:.::::.:|:|:|...|||::|||:|:||:::|:|
  Rat    73 PPYTRVCQVGDPVLRTVAAPVEPKQLAGPELQRLVEQLVQVMRRRGCVGLSAPQLGVPLQVLVLE 137

  Fly    69 FREGKQEQFKPEIYEERKMSILPLAVFINPELEIISSQVNKHPEGCMSVRGYSAEVERYDKVRIR 133
            |.:.....|.|.:.|.|:|...||.|.:||.|.::.|::...||||.||.|:.|.|.|:..|:|.
  Rat   138 FPDRLFRAFSPRLRELRQMEPFPLRVLVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQIS 202

  Fly   134 GIGKLGTPSEMELEGWNARIAQHEVDHLNGTIYMDRMDLSTFNCILWEQIN 184
            |:...|.|......||.|||.|||:|||:|.:::|:||..||..:.|.::|
  Rat   203 GLDPKGEPVVWSASGWTARIIQHEMDHLHGCLFIDKMDSGTFTNLHWMEVN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31373NP_731495.1 Pep_deformylase 7..171 CDD:279645 66/163 (40%)
PdfXP_001073696.3 Pep_deformylase 78..235 CDD:238271 65/156 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354328
Domainoid 1 1.000 151 1.000 Domainoid score I4256
eggNOG 1 0.900 - - E1_COG0242
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 167 1.000 Inparanoid score I4071
OMA 1 1.010 - - QHG59626
OrthoDB 1 1.010 - - D1532656at2759
OrthoFinder 1 1.000 - - FOG0005148
OrthoInspector 1 1.000 - - otm44804
orthoMCL 1 0.900 - - OOG6_101584
Panther 1 1.100 - - O PTHR10458
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4178
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.