DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31373 and PDF

DIOPT Version :9

Sequence 1:NP_731495.1 Gene:CG31373 / 318700 FlyBaseID:FBgn0051373 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_071736.1 Gene:PDF / 64146 HGNCID:30012 Length:243 Species:Homo sapiens


Alignment Length:181 Identity:70/181 - (38%)
Similarity:107/181 - (59%) Gaps:0/181 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PPYRHFTQIGDPVLRQRAEEVPPEDIDSREINQIIDGMVKVLRHYDCVGVAAPQVGIPLRIIVME 68
            ||:.|..|:||||||..|..|....:...|:.::...:|:|:|...|||::|||:|:|.:::.:|
Human    62 PPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALE 126

  Fly    69 FREGKQEQFKPEIYEERKMSILPLAVFINPELEIISSQVNKHPEGCMSVRGYSAEVERYDKVRIR 133
            ..|....:..|.....|:|...||.||:||.|.::.|::...||||.||.|:.|.|.|:..|:|.
Human   127 LPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQIS 191

  Fly   134 GIGKLGTPSEMELEGWNARIAQHEVDHLNGTIYMDRMDLSTFNCILWEQIN 184
            |:...|.....:..||.|||.|||:|||.|.:::|:||..||..:.|.::|
Human   192 GLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31373NP_731495.1 Pep_deformylase 7..171 CDD:279645 62/163 (38%)
PDFNP_071736.1 Pep_deformylase 67..224 CDD:238271 60/156 (38%)
Hydrophobic dimerization interface 165..175 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160278
Domainoid 1 1.000 149 1.000 Domainoid score I4418
eggNOG 1 0.900 - - E1_COG0242
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4173
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59626
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005148
OrthoInspector 1 1.000 - - otm40666
orthoMCL 1 0.900 - - OOG6_101584
Panther 1 1.100 - - O PTHR10458
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17325
SonicParanoid 1 1.000 - - X4178
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.