DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31323 and C30G7.2

DIOPT Version :9

Sequence 1:NP_001247310.1 Gene:CG31323 / 318682 FlyBaseID:FBgn0051323 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001256633.2 Gene:C30G7.2 / 3565427 WormBaseID:WBGene00044176 Length:186 Species:Caenorhabditis elegans


Alignment Length:167 Identity:76/167 - (45%)
Similarity:93/167 - (55%) Gaps:27/167 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LALLLGLFIRSGYC-IDCFKCVSYNGANKACDDPFHNNYSTAILES-------------PCMGGR 64
            |.|.|.:...||.. |.||.|.|::|.||.|:|||:   ||..|.|             ||...:
 Worm    30 LVLSLAVMEASGVSGIGCFVCSSFDGENKGCEDPFN---STMDLSSRDRDASAVANYNYPCWAYK 91

  Fly    65 KGRDGLFPATACIKIAGY-YDGTGETITVRGCALDSGTLTTDTEIIRMSHCGKFYYDDKYVHGCL 128
            |||.|||||..||||.|| .|...:|:.:|.|||||||||.||||:|:||||.|.|:.....||:
 Worm    92 KGRHGLFPADHCIKIVGYRADNESKTLVIRTCALDSGTLTADTEIVRISHCGSFKYEGHQYKGCV 156

  Fly   129 QSCSDADACNSARRQGASPADLESLMRHLLSLVVFLL 165
            ||| |.|.|||        :.:.|.:..|..|:||.|
 Worm   157 QSC-DTDGCNS--------SSVHSFLLPLCFLIVFSL 184



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I3331
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16837
Inparanoid 1 1.050 128 1.000 Inparanoid score I3248
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014313
OrthoInspector 1 1.000 - - oto20267
orthoMCL 1 0.900 - - OOG6_115691
Panther 1 1.100 - - LDO PTHR38332
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16992
SonicParanoid 1 1.000 - - X11772
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.990

Return to query results.
Submit another query.