DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31321 and AT2G16980

DIOPT Version :9

Sequence 1:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001324580.1 Gene:AT2G16980 / 816201 AraportID:AT2G16980 Length:477 Species:Arabidopsis thaliana


Alignment Length:504 Identity:108/504 - (21%)
Similarity:184/504 - (36%) Gaps:124/504 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PDLADLVIGATGFNYTVCKAELEAQILAADVSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMI 168
            |.:.|:.:.|      ||....::..||..::|.:.....:..::::...|..:|||. .|..:.
plant    43 PVMTDVTVAA------VCSGLDDSCSLAVYLTGVQQVTVGMGTMVMMPVIGNLSDRYG-IKAMLT 100

  Fly   169 MPIIGEALSFTCQII-----SSIFFESLPMEFGAYCEAIVPALFG----GLTFCLMAIYSYITIA 224
            :|:   .||.....|     .:.||         |...::..||.    |...||  ..:|:...
plant   101 LPM---CLSVLPPAILGYRRDTNFF---------YAFYVIKTLFDMVCQGTIDCL--ANAYVAKN 151

  Fly   225 TPEEDRVFRFGIFAMFVTGVPFIGQPISGVL------FTTLGYTWSFASAIVFQLIAIFYIIFFI 283
            .....|:..|||.|    ||    ..||||.      |.::..|:..|:..:|  |.:.|:..|:
plant   152 VHGTKRISMFGILA----GV----SSISGVCASLSARFLSIASTFQVAAISLF--IGLVYMRVFL 206

  Fly   284 KEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVP 348
            ||..........|:             .|......|..|..:|:       .||   ||.:...|
plant   207 KERLQDADDDDEAD-------------SGGCRSHQEVHNGGDLK-------MLT---EPILRDAP 248

  Fly   349 PKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLAW 413
            .|..:....:....       .:|...||..:|:..|:..:|.|.. .||.......|...:..:
plant   249 TKTHVFNSKYSSWK-------DMVSLINNSTILIQALVVTFFATFS-ESGRGSALMYFLKARFGF 305

  Fly   414 NGNDFS-IYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALSIVCSRVLFAFSSSTA---- 473
            |.|||: ::|.:        |.||:.....:|....|.||....||   :.:|..|.::|.    
plant   306 NKNDFAELFLLV--------TIIGSISQLFILPTLSSTIGERKVLS---TGLLMEFFNATCLSVA 359

  Fly   474 ---------SFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYS-IFGI---SEPIAQFIFPP 525
                     :..|.|.:.:..|:..||.:.:|||     |..|:.. |.|:   ::.:|.|::.|
plant   360 WSPWVPYAMTMLVPGAMFVMPSVCGIASRQVGSS-----EQGKVQGCISGVRAFAQVVAPFVYSP 419

  Fly   526 IFSEIYKSTVD-SFPG------AIWLFGEIFYIPNVL---VFVVCYFLL 564
            :.:........ .|||      ||.|   :|:....:   :.::|..|:
plant   420 LTALFLSENAPFYFPGFSILCIAISL---VFFTSTTISSVITIICLLLI 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 32/144 (22%)
MFS_1 143..>271 CDD:284993 32/142 (23%)
MFS <379..559 CDD:119392 46/207 (22%)
AT2G16980NP_001324580.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.