DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31321 and MEE15

DIOPT Version :9

Sequence 1:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001323497.1 Gene:MEE15 / 816200 AraportID:AT2G16970 Length:460 Species:Arabidopsis thaliana


Alignment Length:508 Identity:110/508 - (21%)
Similarity:186/508 - (36%) Gaps:151/508 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PDLADLVIGATGFNYTVCKAELEAQILAADVSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMI 168
            |.:.|:.:.|      ||....|...||..::|.......:..::::...|..:|||. .|..:.
plant    28 PVMTDVTVAA------VCSGLNETCSLAVYLTGVEQVTVGLGTMVMMPVIGNLSDRYG-IKTLLT 85

  Fly   169 MPIIGEALS------------FTCQIISSIFFESLPMEFGAYCEAIVPALFGGLTFCLMAIYSYI 221
            :|:....|.            |....|:.|.|:.:       |:..|..|          .::|:
plant    86 LPMCLSILPPAILAYRRDTNFFYAFYITKILFDMV-------CQGTVDCL----------AHAYV 133

  Fly   222 TIATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAI------FYII 280
            ........|:..||:.|    ||    :.||||..|........||  :||:.||      .|:.
plant   134 AKNVCGRKRISMFGVLA----GV----RSISGVCATFSARLLPIAS--IFQVAAISFFFGLVYMR 188

  Fly   281 FFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQG-NKNVNFQLTPQMEP-- 342
            .|:||                         :..|:...:....|...| |.:....||...||  
plant   189 VFLKE-------------------------RLHDDDEDDCDEDDNTSGRNHHDGGDLTMLAEPIL 228

  Fly   343 -----KVEVV-PPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGEND 401
                 |:.:| ..|.|.||::..           |:|   |..:|:..|:..:|.|...:..::.
plant   229 RDAPTKIHIVLNTKYSSLKDMVS-----------LIK---NSTILVQTLVVTFFATFAQSGMQSA 279

  Fly   402 YWYRFTLKKLAWNGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIG---------MLSAL 457
            :.| |...:..:|.|||:..:.|   ..::|:.....||.||:    |.||         ::.::
plant   280 FLY-FLKARFGFNKNDFAELILL---VTIIGSISQLFILPKLV----SAIGERRVLSTGLLMDSV 336

  Fly   458 SIVCSRVLFAFSSSTASFYVAGV---VDMFV--SLRVIAIKTIGSSIVAGDE------LSKMYSI 511
            :..|..|    |.|....|...|   |.|||  |:..||.:.:|    .|::      :|.:.|.
plant   337 NAACLSV----SWSAWVPYATTVLVPVTMFVMPSVCGIASRQVG----PGEQGKVQGCISGVKSF 393

  Fly   512 FGISEPIAQFIFPPIFSEIYKSTVDSFPGAIWLFGEIFYIPNVLVFVVCYFLL 564
            .|:   :|.||:.|: :.::.|  :..|         ||.|...:..|.:.|:
plant   394 SGV---VAPFIYSPL-TALFLS--EKAP---------FYFPGFSLLCVTFSLM 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 28/141 (20%)
MFS_1 143..>271 CDD:284993 28/139 (20%)
MFS <379..559 CDD:119392 46/199 (23%)
MEE15NP_001323497.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.