DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31321 and mfsd14ba

DIOPT Version :9

Sequence 1:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_002663499.2 Gene:mfsd14ba / 557306 ZFINID:ZDB-GENE-200414-1 Length:500 Species:Danio rerio


Alignment Length:484 Identity:103/484 - (21%)
Similarity:166/484 - (34%) Gaps:164/484 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LAADVSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLP-- 192
            |...|.|..:.|:|  |||     |..:|.:.:|             ||   ::.::||...|  
Zfish    88 LIQGVKGLLSFMSA--PLI-----GALSDVWGRR-------------SF---LLVTVFFTCAPIP 129

  Fly   193 -MEFGAYCEAIVPALFGGLTFCLMAIYSYITIATPEEDRVFRFGI----FAMFVTGVPFIGQPIS 252
             |....:....:.::.|..:.....|::||...|.|.:|...:|:    ||..:...|.||..:|
Zfish   130 LMRLSPWWYFAMISVSGAFSVTFSVIFAYIADVTDERERSTAYGLVSATFAASLVTSPAIGAYLS 194

  Fly   253 GVLFTTLGYTWSFASAIVFQLIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQ----GA 313
            ......|       ..:|..|||:..|.|.:..|                |.|||.|.:    ||
Zfish   195 ASYGDNL-------VVLVATLIALADICFILLAV----------------PESLPDKMRLNTWGA 236

  Fly   314 DNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNG 378
            . :::|..:                          |..||.|...|.|::|.||...|...|..|
Zfish   237 P-ISWEQAD--------------------------PFASLRKVGQDTTVLLICITVFLSYLPEAG 274

  Fly   379 RM--------------------------LLILLLCAYFLT-VGPTSGEND---YWYRFTLKKLAW 413
            :.                          :|.:|....||| :..|.|..:   ....|.:.:|||
Zfish   275 QYSSFFLYLRQVINFSPKTIAVFIGVVGILSILAQTLFLTLLMRTIGNKNTVLLGLGFQILQLAW 339

  Fly   414 NGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDS------MIGMLSALSIVCSRV---LFAFS 469
            .|.....::..::||....:.|....:|.|:..|..      :.||::.:..:|:.:   |:.| 
Zfish   340 YGLGSEPWMMWAAGAVAAMSSITFPAVSALVSRSADPDKQGLVQGMITGIRGLCNGLGPALYGF- 403

  Fly   470 SSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKST 534
                .|::..|                       |||      ||: ||......||.:...|:|
Zfish   404 ----VFFLFNV-----------------------ELS------GIT-PIQPDFAIPIQTPTEKTT 434

  Fly   535 VDSFPGAIWLFGEIFYIPNVLVFVVCYFL 563
            :   ||..:|.|....   |:.|:|..|:
Zfish   435 I---PGPPFLLGACTV---VVAFIVALFI 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 29/136 (21%)
MFS_1 143..>271 CDD:284993 28/134 (21%)
MFS <379..559 CDD:119392 42/218 (19%)
mfsd14baXP_002663499.2 MFS 52..409 CDD:119392 83/398 (21%)
MFS_1 54..398 CDD:284993 80/382 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D763423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.