DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31321 and mfsd14bb

DIOPT Version :9

Sequence 1:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_003199082.1 Gene:mfsd14bb / 557243 ZFINID:ZDB-GENE-120215-153 Length:471 Species:Danio rerio


Alignment Length:470 Identity:109/470 - (23%)
Similarity:166/470 - (35%) Gaps:144/470 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LAADVSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPME 194
            |...|.|..:.|:|  ||:     |..:|.:. ||..:::.:.     |||..|.  .....|..
Zfish    55 LIQGVKGLLSFMSA--PLV-----GALSDVWG-RKSFLLLTVF-----FTCAPIP--LMRISPWW 104

  Fly   195 FGAYCEAIVPALFGGLTFCLMAIYSYITIATPEEDRVFRFGI----FAMFVTGVPFIGQPISGVL 255
            |.|...  |..|| .:||.:  |::|:...|.|.:|...:|:    ||..:...|.||      .
Zfish   105 FFALMS--VSGLF-SVTFSV--IFAYVADITEEHERSTAYGLVSATFAASLVTSPAIG------A 158

  Fly   256 FTTLGYTWSFASAIVFQLIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYET 320
            |.::.|..|.. .::..:||:..|:|.:..|                |.|||.|.:         
Zfish   159 FLSIHYGDSLV-VLLATIIAVLDILFVLLVV----------------PESLPDKMR--------- 197

  Fly   321 TNLDELQGNKNVNFQLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILL 385
                    ..:..|.::      .|...|..||.|...|.|::|.|:...|...|..|:      
Zfish   198 --------LSSWGFPIS------WEQADPFASLRKVGKDSTVLLICVTVLLSYLPEAGQ------ 242

  Fly   386 LCAYFLTVGPTSGENDYWYRFTLKKLAWNGNDFSIYLTLSSGA-----ALVGTF-IG--TAILSK 442
            ..::||.:|..                         :..||.|     |:||.. ||  |.:||.
Zfish   243 YSSFFLYLGQV-------------------------INFSSAAIAGFIAMVGILSIGAQTLLLSV 282

  Fly   443 LLKVSDSMIGMLSALSIVCSRVLF-----AFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAG 502
            |:|    .||..|.:.:.....||     .|.|.....:.||.|....|:...||..:.|.....
Zfish   283 LMK----KIGNKSTVLLGLGFQLFQLAWYGFGSEPWMMWAAGAVAALSSITFPAISALVSRCTDR 343

  Fly   503 DELSKMYSIF----GISEPIAQFIFPPIF-------SEIYKSTVDS-------------FPGAIW 543
            |:...:..|.    |:...:..|:|..||       ::|  |||.|             .||..:
Zfish   344 DQQGAVQGIITGIRGLCNGLGPFLFGFIFFLFNVELNDI--STVQSNSAVTPDTKQKSVVPGPPF 406

  Fly   544 LFGEIFYIPNVLVFV 558
            :||....:..:||.|
Zfish   407 VFGACTVVLALLVAV 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 34/133 (26%)
MFS_1 143..>271 CDD:284993 33/131 (25%)
MFS <379..559 CDD:119392 49/217 (23%)
mfsd14bbXP_003199082.1 MFS 16..365 CDD:119392 93/410 (23%)
MFS_1 21..365 CDD:284993 93/410 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D763423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.